KEGG   Aureococcus anophagefferens: AURANDRAFT_37947Help
Entry
AURANDRAFT_37947  CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
aaf  Aureococcus anophagefferens
Pathway
aaf00020  Citrate cycle (TCA cycle)
aaf00190  Oxidative phosphorylation
aaf01100  Metabolic pathways
aaf01110  Biosynthesis of secondary metabolites
aaf01130  Biosynthesis of antibiotics
aaf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AURANDRAFT_37947
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AURANDRAFT_37947
Enzymes [BR:aaf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AURANDRAFT_37947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO FAD_oxidored HI0933_like
Motif
Other DBs
NCBI-GeneID: 20221826
NCBI-ProteinID: XP_009038442
JGI: Auran1_37947
UniProt: F0YDU4
LinkDB All DBs
Position
Unknown
AA seq 629 aa AA seqDB search
MQAARAVQRVSRSRNARALSTVSGLKGDYTVVDHSYDVCVVGAGGAGLRAAMGAAEAGFK
TACVTKLFPTRSHTVAAQGGINAALGNMSEDDWKWHMYDTVKGSDWLGDQDAIHYMCREA
PQAVLELESFGLPFSRTDDGKIYQRAFGGQSLDYGKGGQAYRCCAAADRTGHAMLHTLYG
RSLAFDTTYFLEYFALDLIMDDEGSCVGIVAINMEDGTLHRINASNTVLATGGYGRAYFS
CTSAHTCTGDGNAMALRAGLAAEDPEFVQFHPTGIYGAGCLITEGCRGEGGILRNSEGER
FMERYAPSAKDLASRDVVSRAMTMEIREGRGVGKDADHCYLHLDHLPAELLAERLPGISE
TAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNHLGEVIRQVTGPDGSVIDHDEVVPGLFAA
GEAACASVHGANRLGANSLLDIVVFGRACALRIADIAEPGAPVPPLPADAAEKTIADVDA
IRFSSGPRPTADVRKDMQKTMQDHAAVYRTAESLAEGCEKIQKNVEAFADIGVTDRSLIW
NTDLIETIELRNLLPNAATTMFAAEARKESRGAHAREDTPDRLDDEWMKHTMCYFDEATN
KTTVTYRPIHYETLDADECPVVPPVARVY
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctgcgcgcgccgtccagcgcgtctcgcggtcgcgcaatgcgcgcgccctgtcc
acggtgtccgggctcaagggcgactacacggtcgtggaccacagctacgacgtctgcgtc
gtcggcgccggcggcgcgggcctgcgcgcggccatgggcgccgccgaggcgggcttcaag
acggcctgcgtcacgaagctcttccccacgcggtcccacacggtcgccgcccagggcggc
atcaacgcggcgctcgggaacatgagcgaggacgactggaagtggcacatgtacgacacc
gtcaagggcagcgactggctcggcgaccaggacgcgatccactacatgtgccgcgaggcg
ccccaggccgtgctcgagctcgagtccttcggcctcccgttctcgcgcacggacgacggc
aagatctaccagcgcgcgttcggcggccagtcgctcgactacggcaagggcggccaggcg
taccggtgctgcgcggccgcggaccgcacgggccacgccatgctccacaccttgtacggc
cggtccctggccttcgacacgacctacttcctcgagtacttcgccctggacctgatcatg
gacgacgaggggtcgtgcgtcggcatcgtcgccatcaacatggaggacggcacgctccac
cgcatcaacgcgtcgaacacggtgctcgccacgggcggctacggccgcgcctacttctcc
tgcacgtcggcgcacacgtgcacgggcgacggcaacgcgatggcgctgcgggcgggcttg
gccgcggaggacccggagttcgtccagttccacccgacgggcatctacggcgccggctgc
ctcatcacggagggctgccgcggcgagggcggcatcctccggaattccgagggcgagcgc
ttcatggagcgctacgcgccgtccgcgaaggacctcgcgagccgcgacgtcgtctcgcgc
gcgatgacgatggagatccgcgagggccgcggcgtcggcaaggacgcggaccactgctac
ctccatcttgatcatttacccgcggagttgttggccgagcggctcccgggcatctcggag
acggccgcgatcttcgcgggcgtcgacgtgaccaaagagcccatccccgtgctcccgacg
gtccactacaacatgggcggcatcccgacgaaccacctcggcgaggtcatccgccaggtc
acgggccccgacggctccgtcatcgaccacgacgaggtcgtgcccggcctcttcgcggcc
ggcgaggcggcctgcgcgtccgtgcacggggccaaccgcctcggcgccaacagtctcctc
gacatcgtcgtcttcggccgcgcctgcgcgctgcgcatcgccgacatcgccgagcccggc
gcgcccgtgccgccgctgcccgcggacgccgcggagaagaccatcgcggacgtcgacgcg
atccgcttctccagcggcccgcggcccacggccgacgtgcgcaaggacatgcagaagacc
atgcaggaccacgccgccgtctaccgcacggccgagagcctcgccgagggctgcgagaag
atccagaagaacgtcgaggccttcgcggacatcggcgtcacggaccggagcctcatctgg
aacacggacctcatcgagaccatcgagctccgcaacctgctccccaacgcggcgacgacc
atgttcgccgccgaggcgcgcaaggagagccgcggcgcgcacgcgcgggaggacacgccc
gaccgcctcgacgacgagtggatgaagcacacgatgtgctacttcgacgaggcgacgaac
aagacgacggtgacctaccggcccatccactacgagaccctcgacgccgacgagtgcccc
gtcgtgccccccgtcgcccgcgtctactag

DBGET integrated database retrieval system