KEGG   Aedes aegypti (yellow fever mosquito): 110676733Help
Entry
110676733         CDS       T01053                                 

Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Chromosome and associated proteins [BR:aag03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    110676733
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110676733
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 110676733
NCBI-ProteinID: XP_021701438
LinkDB All DBs
Position
2
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtaccaagcagaccgctcgtaagtccaccggaggaaaggctccccgtaaacag
ctggccaccaaagccgctcgtaagagcgctccagccaccggaggagtaaagaagccccat
cgctaccggccgggaactgtcgccctgcgtgagatccgtcgttaccagaagtcgaccgaa
ctcttgatccgcaagctaccattccaacgcctggtccgagagatcgcccaggatttcaag
accgatctacgcttccagagctcggccgtcatggctctgcaggaagccagtgaagcatat
ctagttggcctgttcgaagatactaatctgtgtgccatccatgctaagcgcgtaacgatc
atgccaaaagacattcaactggcccgtcgcattcgcggagaacgtgcttaa

DBGET integrated database retrieval system