KEGG   Aedes aegypti (yellow fever mosquito): 110677859
Entry
110677859         CDS       T01053                                 

Definition
(RefSeq) cell death protein hid
  KO
K20016  cell death protein hid
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag04013  MAPK signaling pathway - fly
aag04214  Apoptosis - fly
aag04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:aag00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    110677859
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110677859
   04215 Apoptosis - multiple species
    110677859
SSDB
Other DBs
NCBI-GeneID: 110677859
NCBI-ProteinID: XP_021705280
LinkDB
Position
3
AA seq 392 aa
MAIPFLQPEEDESARHGNGQLVHAGAGAGAGSSAASGSAGSSSGVVGAGSGIAASGGGAV
MMVGATGPLPIPNSPAPISSGTSTAVQTPLIGPMNSDQLVQLFYEALYRYSRGDTPSTPI
SQSPQSSSCSPFTTGYYNSGGGGGSAGFVNTGTTSQVFFPQTPNGVYRPSGVGSFGTTGV
FFGQPPTPSPSGSSSHSSQHSANSPETPACSSAPPIFHQFPSSYQLPSTANASTTTNWSH
HGGPSGHDGDESSESDSSQPSSISEGDTIAAPIAACSPHCLGLLPGAHHHLLDAGSSTST
STIGANSSSSGSSSTMATMSGYIPPHLDYMAGREQLQEFAGKIPQRKKKSSSSSKSSSKS
KKSKFLEQTLVWPTLAVTATLIALGCGLLAAR
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcaattccattcttgcaaccggaagaagacgaaagtgcccggcacggaaatggacag
ctcgtccatgccggtgctggtgctggtgcaggaagtagtgccgctagtggaagtgctggt
agtagtagtggagtagttggagccggtagtggaatcgcagccagtggtggtggcgccgtg
atgatggttggtgctaccgggccactgccaattccaaattcgccggctcccatcagtagt
ggaacgtcgacggcagtgcagacgcccctgattgggccgatgaacagcgaccagttggtg
cagcttttctatgaggcgctgtatcgctactcgagaggagataccccctcgacgccgatc
tcgcagtcaccgcaaagctcgtcctgcagtccattcaccactgggtattacaacagcgga
ggaggtggaggaagtgctggattcgtcaacaccggcaccacaagccaggtgttcttcccg
cagacccccaacggagtgtaccgtccgagcggagtcggaagttttggaactacgggagtg
ttctttgggcagcctccgaccccgagtcccagtggaagtagtagccacagcagccaacac
agtgccaacagtccggaaacgccggcctgctcgtcggcgccaccaatttttcaccagttc
ccatcgagctaccaactgcccagcaccgcaaacgccagcaccaccaccaactggagtcac
cacggtggtcccagtggccacgatggagatgaatcgagcgaatcggactcctctcagcca
tcgtccatatcggaaggagataccattgccgctcccatagccgcatgcagccctcactgt
ttgggactgctaccgggggcacatcaccatctcctcgacgccggaagcagcaccagtacc
agtaccatcggtgccaacagtagtagcagcggtagcagtagcaccatggccacgatgagt
ggatacattccgccgcatttggactatatggctgggcgtgaacagctgcaggagttcgcc
ggcaagatcccccagcgcaagaagaaatcgtcgtcgtcgtccaaatcttcgagcaagtcc
aagaaatcaaaatttctggagcaaaccctcgtctggccaaccctggccgtgaccgccacg
ttgatcgccctcggctgtggcctactagctgcccggtga

DBGET integrated database retrieval system