KEGG   Aedes aegypti (yellow fever mosquito): 110681501
Entry
110681501         CDS       T01053                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag04013  MAPK signaling pathway - fly
aag04214  Apoptosis - fly
aag04215  Apoptosis - multiple species
aag04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:aag00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    110681501
   04391 Hippo signaling pathway - fly
    110681501
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    110681501
   04215 Apoptosis - multiple species
    110681501
SSDB
Motif
Pfam: TNFR_c6 CENP-Q Trp_oprn_chp
Other DBs
NCBI-GeneID: 110681501
NCBI-ProteinID: XP_021713061
LinkDB
Position
1
AA seq 367 aa
MPPWIESMEQRRRRSTRNLPESSSSSGSWSVRSVMYSSSGASGSSGSFSNSFSISPVAVS
STPVSRLRWMFGALTLLTVLSRAEAVCDPDRWWNLEREECDPCTVCGEQQLVLRPCQEYM
DTVCGTIGDLDMDLAQLARTEARHEQRHWKEERRKDGSDGPQQHRSHQHHANQQHPHPGT
ARKHENTEEILWDWQAASLLLAIIGCLMFFFAAAIIALNQTRQWKRIEKHFDADMEALSA
QLMNHLSSMQQLENGSIFLDDVLGGDQRRFHRGGGERSGDSVSSTSALLGGHHHHHHHHP
IEVRCVYLDQLLDGKNCIQSQGPGNLYIEETNNTPNVDRGTTAAAVSQPPACHFPNGGSP
LNRVRLY
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgccaccttggatcgagtccatggagcagcgccgtagaagatccacgcggaacctgccc
gagagcagtagcagtagcggtagctggtccgtccgatcagtcatgtacagtagtagtggc
gctagtggtagcagcggtagttttagcaatagtttctcaataagtccagtagctgtaagt
tcgacgccggtatctaggctaagatggatgttcggcgcgttgaccttgttgacagtatta
tccagggcggaagcggtgtgtgatccagatcggtggtggaatctggaacgggaagagtgc
gacccgtgtacggtgtgtggtgagcagcagctggtcctgaggccgtgtcaggaatacatg
gacacggtctgcgggacgatcggggatctggatatggatctggcgcagttggcgcgtacc
gaagcacgccacgagcagcgccactggaaggaggaacgccggaaagacggttccgacggg
ccccagcagcatcggtcgcatcagcaccacgccaaccagcaacacccacatccgggcacg
gccagaaagcacgagaacaccgaagaaatcctgtgggactggcaggcggcctcgctgctg
ctggccatcatcggatgtctgatgttcttcttcgccgcggccatcattgcgctgaaccag
acgcgccagtggaagcgaatcgagaaacattttgacgcggacatggaggccctgtcggcg
cagctgatgaaccatctgtccagcatgcagcagctcgagaacggatcgatcttcctggat
gacgttcttggaggtgatcagcgacggttccaccggggaggaggagaacgcagtggagac
agtgtgagtagcactagcgctctgctcggaggccaccaccatcatcaccatcaccatccg
atcgaggtgcgatgtgtctacttggatcagttgctagacggcaagaattgcatccaaagt
cagggcccgggcaatttgtacatcgaagagacaaacaacaccccaaacgtggaccgtgga
acgacagccgcagcagtttcccaaccgccagcgtgtcatttccctaacggtggttctcca
ctgaatcgagttcgattgtattga

DBGET integrated database retrieval system