KEGG   Aedes aegypti (yellow fever mosquito): 23687880Help
Entry
23687880          CDS       T01053                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Enzymes [BR:aag01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     23687880
Peptidases [BR:aag01002]
 Metallo Peptidases
  Family M2
   23687880
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   23687880
CD molecules [BR:aag04090]
 Proteins
  23687880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Glyco_hydro_85
Motif
Other DBs
NCBI-GeneID: 23687880
NCBI-ProteinID: XP_011493088
UniProt: J9E9A1
LinkDB All DBs
Position
2
AA seq 620 aa AA seqDB search
MWWRFSLLVLAAVAVALAANPQLEEDELAALKYVNDLEQEILARNNEATEASWAYESNLT
EDNLKQRNEIQTRNANYFKEVARELRKFNYKDFKDADLKRKIKKMTDLGYAALAEDKFTQ
LLDAISSMSENYAMAKVCDYKDRTKCDLSLEPELTETLATSRDPEELKHYWTQWYDAAGA
PTRDNFLKYVQLNKEAAELNGYTSGAESWLDAYEDESFEAQVDAAIEEIRPLYEQIHAYV
RHRLRERYGEAVVSEKGPIPMHLLGNMWAQTWDNIADFTTPFPESRQLDVTEEMVRQGYN
PIQMFKMGDEFFMSLNMTELPATFWEKSILEKPTDGRELVCHASAWDFYRKDDVRIKQCT
RVNMEDFFTVHHELGHIQYYLQYQHQPSMYREGANPGFHEAVGDVLSLSVSTPKHLEKIG
LLKDYVMDEESKVNQFYRSGLGKLVFLPFAYTIDKYRWGIFRGDIQPHEYNCKFWEMRSK
YSGIEPPVVRTEKDFDAPAKYHVSADVEYLRYLVSYIIQFQFHRSACELAGEYVKGDPEK
TVNNCDIYQSVNAGNAIKEMLAMGSSKPWPDAMEALTGQRKMSADALLEYFQPLYDWLVV
ENKRLGAYVGWEPTEKCKPE
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtggtggcgattctcgctgttggtgctagcggccgtggccgttgctttggccgccaat
ccccagctggaggaggacgagctggccgccctcaagtacgtgaacgatctggagcaggag
attctggcccgcaacaatgaagctaccgaggcttcctgggcgtatgaatctaacctgacc
gaggataacctgaagcagcgcaacgaaatccagacgcgtaacgccaactacttcaaggaa
gttgcccgtgaactgcgcaagttcaactacaaggacttcaaggatgccgatctgaagcgt
aagatcaagaagatgactgatctgggatacgctgctctagcggaagacaagttcacacag
ctgttggatgccatctcgagcatgtcggagaactacgccatggccaaggtgtgcgactac
aaggatcgtaccaagtgcgacctttcgttggaacctgaactgaccgaaactctggctacc
agtcgtgatccggaggaactgaaacactactggacccagtggtacgatgctgctggagcc
ccgacccgggataacttcctcaagtacgttcagttgaacaaggaagccgctgaattgaac
ggttacacttctggcgctgaatcttggttggatgcctatgaggatgaatcgttcgaggcc
caagtcgacgcagccatcgaagaaatccgtccactttacgaacagattcacgcctacgtt
cgtcatcgtctgcgcgaacgctacggagaagccgttgtctcagagaagggacccatcccg
atgcatctgctcggaaacatgtgggctcagacctgggataacatcgccgatttcactact
cccttcccggaaagccgccagctggatgtaaccgaagagatggtccgacagggctacaac
ccaatccagatgttcaagatgggtgacgagttcttcatgtctctcaacatgaccgaattg
ccagccaccttctgggaaaagagtatcctggagaaaccaaccgacggtcgtgaattggtg
tgccatgcgtctgcctgggacttctaccgcaaggacgacgtccgcatcaagcagtgcact
cgcgtgaacatggaagactttttcaccgtacaccacgaacttggtcatatccagtactac
ctgcagtaccagcaccaaccgagcatgtaccgcgaaggagccaaccctggattccacgag
gccgttggtgacgttctgtccctctccgtctcaacccccaaacacttggaaaaaatcggc
ctcctcaaggattacgtcatggacgaagaatccaaggtcaaccaattctaccgctccgga
ttgggcaaactggtgttcctgccattcgcctacaccatcgacaagtaccgctggggaatc
ttccgcggagacatccaaccccacgagtacaactgcaagttctgggaaatgcgctccaag
tactccggaatcgaaccgccagtcgtgcgtaccgagaaggacttcgatgccccggccaag
taccacgtgtcggctgatgtggaatacctgcgttacctggtttcgtacatcatccagttc
cagttccatcgttcggcttgcgagttggccggcgagtacgtcaagggcgatccggagaag
actgtcaacaactgtgatatctaccagagtgtgaacgccggcaatgccatcaaggagatg
ctggccatgggatcttcgaagccgtggcccgatgcgatggaagccctgaccggacagcgc
aagatgagtgccgatgctctgctggaatacttccaaccactgtacgattggttggtggtg
gagaacaagcgcctgggagcgtacgttggatgggagccgaccgagaaatgcaaaccggaa
tga

DBGET integrated database retrieval system