KEGG   Aedes aegypti (yellow fever mosquito): 5565454Help
Entry
5565454           CDS       T01053                                 

Definition
(RefSeq) maltase A1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00052  Galactose metabolism
aag00500  Starch and sucrose metabolism
aag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    5565454
   00500 Starch and sucrose metabolism
    5565454
Enzymes [BR:aag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     5565454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Porphyrn_cat_1 PBP3
Motif
Other DBs
NCBI-GeneID: 5565454
NCBI-ProteinID: XP_001649786
UniProt: Q17NL7
LinkDB All DBs
Position
3
AA seq 615 aa AA seqDB search
MAGSNRLARIFLLLLPVWFVGAQNTNLRSLTASDWWEKSGFYQIYPRSFKDSNGDGIGDL
NGITQKLPYLKSLGVKAFWLSPIYKSPMADFGYDISDFRDIHPEYGTMDDFKNLVKEAKK
LDLKVILDFVPNHSSDEHEWFVKSENRESGYEDYYVWHDGKPGSNLEQNDPPNNWVQSFR
GSAWQWSEKRRQYYLHQFHRKQPDLNYRNPKVVEEMKNVMRFWLDLGVDGFRIDAVQWLF
EDDNFLDEPVSGNSQDPLMPEYLNHIYTQNLPETVDMVYQWREAMDNYKKQNGGDTRVLM
TECWSDLSIIKTYFEDENKRQGSQMPFNFQLILHLDANNKKASDFKTVIDSWLNTVPDRR
SPNWVLGNHDKRRVASRMGGEHMVDIMGIVQLSMPGVSVTYQGEEIGMLDTELTWAETVD
PAACQTSPEVYKLYTRDPARTPFQWDATTNAGFTNHSKPWLPVSQMYKTVNVQVEESASW
SHLKLYKELLKLRESDDFHNCHYQTAVLGNNVFAILRSGPVLAESDVYVTLVNLANETST
VNITSLYQQYRLRSNAKVKVLVRSVSSKRKSEEEVTPDKLSLQPYEGLVLRSSAVQLMGK
VGFILVTILFFVTRR
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggctggaagtaatcgattagcgcgtatttttctgctactgcttccggtatggttcgta
ggtgctcaaaatacgaacctaagaagtcttactgcgagcgattggtgggagaaatccggt
ttctatcaaatctacccgcgatccttcaaggatagtaacggtgatgggataggcgacctg
aacggaatcactcagaagctgccgtacttaaaatctctaggagtgaaggctttctggctg
tcgcctatctacaagagtcccatggccgatttcgggtacgatatttctgattttcgtgac
attcatccagagtatggcacaatggatgactttaaaaatttggtgaaagaagcgaagaag
ttagatttgaaagtgattctggattttgtgcccaatcattcgagtgatgaacacgagtgg
ttcgtaaagagtgaaaaccgtgaatcaggctatgaggattactatgtgtggcacgatggt
aagcctggcagcaatctcgagcagaatgatccaccgaataattgggtgcaatctttccgc
ggcagtgcttggcagtggagcgagaaacgtagacaatattatctgcatcagtttcatcgc
aagcaaccggatctgaactatcgtaaccctaaagtcgtcgaagagatgaaaaatgtcatg
cgattctggttggatctaggagttgacggttttcgtatcgatgcagtgcaatggctgttt
gaggacgacaattttttggatgaaccagtttcgggcaactctcaggaccctttgatgcct
gaatacttgaatcatatctatacgcagaatttacctgaaacggtcgatatggtataccag
tggcgtgaagctatggataactacaagaaacaaaatggcggcgatacaagagttctaatg
acggaatgttggtccgatctttcaatcatcaaaacctatttcgaagatgaaaacaaaaga
caaggttctcaaatgccgtttaatttccagttgatccttcatttggatgctaataataaa
aaggcatctgactttaaaacggtcattgattcatggcttaacactgtacccgatagacgc
agcccaaattgggtcctggggaaccacgacaaacgtcgtgttgcgtcacgtatgggcgga
gagcatatggtggatatcatgggaatagttcaactatcaatgccaggcgtgtccgtgacc
tatcagggcgaggaaatcggaatgttggataccgaactgacttgggctgaaactgtggat
cctgcagcatgtcagacatctcccgaagtgtacaaattgtacacaagagatccagcccgc
actccattccagtgggatgcgacaaccaacgcaggctttacaaaccattccaaaccgtgg
cttccggtttcccagatgtacaaaacagtcaacgttcaagtcgaagagtctgctagctgg
agccatttgaagctgtacaaagaattgctaaaactacgtgaatcggacgatttccacaat
tgtcactatcagacggcagtgcttgggaacaacgtttttgctatcttgcgatcgggacca
gtattggctgaatcagacgtttacgttactttggtaaatctggcaaacgaaacatcgacc
gtgaacataacttctttgtaccagcaataccgtctaagatctaacgcgaaagttaaggtc
ttggtacggagcgtgtcgtcaaaaagaaagagcgaagaagaggttacgccagataaactc
agcttgcagccatatgagggattggtgcttagaagttcagccgtgcaactcatgggtaaa
gttggctttatactggtcacaatactatttttcgtgacgaggcgttaa

DBGET integrated database retrieval system