KEGG   Aedes aegypti (yellow fever mosquito): 5566922Help
Entry
5566922           CDS       T01053                                 

Definition
(RefSeq) trypsin-2
Organism
aag  Aedes aegypti (yellow fever mosquito)
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 5566922
NCBI-ProteinID: XP_021709641
LinkDB All DBs
Position
3
AA seq 260 aa AA seqDB search
MTRSTVLITIVGLVLTEGFKLGLNNENEDSIKIVGGHPIGIEQAPYQVSVQVKSKSSQRH
ICGGTILSADKVLTAAHCIEEGTKYAVRAGSNNHGRGGQLVNVLDYRVHPEFSDYYLTND
VAMLRLERHLFFSRSVALIGMAYSEYFYTAPKEVFVSGWGSILYDSSLSDRLQGVSIPLV
SHEQCSQLYAEFNNVTESMFCAGQVEKGGKDSCQGDSGGPVVMNGYLVGVVSWGYGCAEP
KYPGVYSKVYSFREWIQSLL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcagtacagtgttgatcacaattgttggcctcgtgctaaccgaaggtttcaaa
ctaggtctaaacaatgaaaatgaagacagtattaaaattgttggaggacatccaattgga
atcgaacaggctccctatcaggtttcggttcaggtcaaatctaaatcgtcccagcggcac
atttgcggcggaacgattttgagcgccgacaaagttctgactgcagcccactgcatagaa
gagggaactaaatacgcggtgcgggcgggctccaacaatcacggtcgcggaggccaactg
gtgaatgttctggactaccgagtccacccggagttcagcgattactatctgacaaacgac
gtcgccatgctgcggctcgagaggcatctcttcttcagcagatcggtcgcactgatcggg
atggcctattcggagtacttctacacggcgccgaaggaggtgttcgtttccggttgggga
tcgattctgtacgactcgtcgctctcggatcggctgcaaggggtttctatcccgctggtg
agccacgaacagtgttcccagctgtacgccgagtttaataacgtgacggaatcgatgttc
tgtgccggccaggtcgagaagggcggcaaggattcctgccagggtgactccggcggtcca
gtggtgatgaacggatacttggttggggtggtttcctggggctacgggtgcgccgagccg
aagtatcccggagtttactcgaaggtgtactccttccgggagtggattcagtcgttgctg
tga

DBGET integrated database retrieval system