KEGG   Aedes aegypti (yellow fever mosquito): 5568355Help
Entry
5568355           CDS       T01053                                 

Definition
(RefSeq) glutathione S-transferase 1 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00480  Glutathione metabolism
aag00980  Metabolism of xenobiotics by cytochrome P450
aag00982  Drug metabolism - cytochrome P450
aag00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    5568355
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    5568355
   00982 Drug metabolism - cytochrome P450
    5568355
   00983 Drug metabolism - other enzymes
    5568355
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aag02000]
    5568355
Enzymes [BR:aag01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     5568355
Transporters [BR:aag02000]
 Other Transporters
  Pores ion channels [TC:1]
   5568355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 5568355
NCBI-ProteinID: XP_001658009
UniProt: Q17MA9
LinkDB All DBs
Position
1
AA seq 216 aa AA seqDB search
MDFYYLPGSAPCRAVQMTAAAVGVELNLKLTNLMAGEHMKPEFLKLNPQHCVPTLVDGDF
SLWESRAIMIYLVDRYAKGEKLYPKDPQKRAVVNQRLYFDMGTLYQRFGDYYYPQIFEGA
AANSENYRKIGEALEFLEVFLHDQQFVAGGNCLTLADLSVLATLTTFEVAGYDFSGYKSV
HEWYGRIQKVALGADINREWAEAARQFFEKVKAPAQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggatttctactacctgccaggatctgccccgtgccgtgccgtccagatgactgcagcc
gccgttggcgtggagctgaaccttaagctcaccaacctgatggccggtgaacacatgaag
cccgagttcctcaagctgaacccgcagcactgcgttccgacgctggtcgacggcgacttt
tcgttgtgggagtctcgagcgatcatgatctacctggtggatcggtatgcaaagggggag
aaactgtacccgaaagatccgcagaagcgagccgtggtcaatcagcggttgtacttcgat
atgggaacactgtatcaacggttcggcgattactactatccgcagatattcgaaggagct
gctgcaaattcggaaaactaccggaagatcggagaagcgttggagtttttggaagtattt
ttgcacgatcaacagttcgtggctggagggaactgcctaacgctagcggatttgagtgta
ctggcaacacttacaacgtttgaagtggccggatatgacttttcggggtacaaaagtgtt
cacgagtggtatggaaggattcagaaggtggctctgggtgccgacatcaatcgagagtgg
gcagaagctgctcgacaatttttcgaaaaggttaaagcccctgcgcagtag

DBGET integrated database retrieval system