KEGG   Aedes aegypti (yellow fever mosquito): 5568472Help
Entry
5568472           CDS       T01053                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase isoform X2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00010  Glycolysis / Gluconeogenesis
aag00030  Pentose phosphate pathway
aag00051  Fructose and mannose metabolism
aag00052  Galactose metabolism
aag01100  Metabolic pathways
aag01200  Carbon metabolism
aag01230  Biosynthesis of amino acids
aag03018  RNA degradation
Module
aag_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5568472
   00030 Pentose phosphate pathway
    5568472
   00051 Fructose and mannose metabolism
    5568472
   00052 Galactose metabolism
    5568472
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    5568472
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aag01009]
    5568472
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aag03019]
    5568472
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     5568472
Protein phosphatases and associated proteins [BR:aag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5568472
Messenger RNA biogenesis [BR:aag03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     5568472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 5568472
NCBI-ProteinID: XP_001652300
UniProt: Q174J0
LinkDB All DBs
Position
2
AA seq 790 aa AA seqDB search
MAPLAPVQRFIQHGAHKGKGIAVFTSGGDSQGMNAAVRAVVRMGIYVGCKVYFIREGYQG
MVDGGDNIVEANWASVSSIIHRGGTVIGSARCMDFKERAGRLKAALNLVTRGITNLVVIG
GDGSLTGANLFRQEWSSLLDELLSTGKITQDQRTKNKSLHIAGMVGSIDNDFCGTDMTIG
TDSALHRIIEAIDAIVSTAYSHQRTFIMEVMGRHCGYLAVVAGLCIEADYIFIPEDPPKP
DWPERMCRQLNQERSAGQRLNIIIVSEGAIDREGQPITAEKVKQVVVDKLHQDTRITVLG
HVQRGGNPSAFDRVLGCRMGAEAVLALMEADDKTEPCVVSLDGNQAVRVPLMECVQRTKA
VAQAMADKNWEMAVELRGRSFARNLETYKMLTRLKPPKEAFDSQGRGVGGYTMAVMHIGA
PACGMNAAVRSFVRNCIYRGDSVMGIHDGIEGLVAGNIKNMGWSDVTGWVGQGGAFLGTK
RTLPEGKFKEVAARLKEHGIQALLIIGGFEAYHAAGQLADQRDNYKEFCIPIVVIPSTIS
NNVPGTEFSLGADTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLSGLAGGA
DAAYIYEEKFSIKDLQQDVYHMASKMSDGVQRGLILRNEKASDNYNTEFIYRLYSEEGKG
LFSTRMNVLGHMQQGGSPTPFDRNMGTKMAAKCVEWLVEQLKANTQPDGSICAKSPDTAC
LLGLVRRQYKFSPLKDLIAETNFEQRIPKQQWWLKLRPLLRILAKHDSTYEEEGLYITVD
EEMSTDSPVA
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggcaccactagctccagttcaacggtttatccaacatggtgcgcataaaggcaaaggt
attgccgtcttcaccagtggtggagattcgcagggcatgaatgcggccgtccgtgccgtt
gtccgaatgggcatttacgtcggatgtaaggtctacttcatccgcgagggttaccagggc
atggtcgatggcggtgacaacatcgtggaagccaactgggcctcggtatccagtattatc
catcgcggtggtaccgtcatcggttctgcccgctgcatggacttcaaggaacgagccggt
cgtttgaaggccgccctcaacctggtcacccgtggaatcaccaacctggtggtgatcggt
ggtgacggttcgctgactggcgccaacctgttccgacaggaatggtccagtttactggac
gaactgctgtcaacgggtaagatcactcaggaccagcgcaccaagaacaagagcttgcac
attgccggcatggtcggttcgatcgataacgacttctgcggtacggatatgaccatcggt
acggattcggctctgcacaggatcatcgaagctattgatgccatcgttagtactgcctac
tctcaccagagaaccttcattatggaggtcatgggcagacactgtggttatctcgcagta
gtcgccggcctgtgcattgaggctgattacattttcattcccgaagatccaccaaaaccc
gattggcccgaaagaatgtgccgccaattgaaccaggagcgctccgccggtcaaagattg
aacattatcatcgtatcggagggtgccatcgatcgcgagggtcagcccatcacggccgaa
aaggtcaaacaggtggtggtcgacaagctgcaccaggacaccaggattacggtgctgggt
catgtgcagcgcggaggtaacccgagtgcgttcgatcgcgtactgggttgccgcatgggt
gctgaagcagtgctggcgctgatggaagcggacgacaaaaccgaaccgtgcgtcgtatcg
ttggacggaaaccaagccgtgcgagtcccactcatggaatgtgtccagcgcaccaaagcc
gtcgcccaagccatggctgacaaaaactgggaaatggccgttgaacttcgtggtcgctcc
ttcgccagaaacttggagacctacaagatgttgacccgcctgaagccaccgaaggaggct
ttcgattcccaaggtcgtggagtcggtggatacaccatggccgtgatgcacattggtgcc
ccagcttgcggtatgaacgctgctgttcgatcattcgtgaggaactgtatctaccgaggt
gactccgtgatgggtattcacgacggtatcgaaggtttggttgccggaaacatcaagaac
atgggatggtccgacgtgactggctgggtcggacagggtggtgctttcctaggtaccaag
cgtacccttccagagggaaaattcaaggaagttgcagcccgtctgaaggaacatggcatc
caggcccttctcatcatcggcggatttgaagcctaccatgctgctggacagttggcagat
caacgcgataactacaaggagttctgcatccctatcgtggttattccatcgaccatttcc
aacaacgttcctggaacagagttctctctaggtgccgataccggtctgaatgaaatcacc
gagatttgtgaccgcatccgtcaatcggctcagggtactaaacgccgtgtcttcgttatt
gaaactatgggcggctactgcggttacttggctaccttatcgggtttggctggtggtgcc
gatgctgcctacatctacgaggagaagttctccatcaaggacttgcagcaggatgtgtac
cacatggcatcgaagatgagcgacggcgttcaacgtggtttgattctgcgtaatgagaag
gcttccgacaactacaacaccgagttcatctaccgtttgtactcggaggaaggcaaggga
ttgttctccacccgaatgaatgtgctgggtcacatgcaacagggtggctcaccgacgccc
ttcgatcgtaacatgggtaccaagatggcggccaagtgcgttgagtggctggtggagcag
ctgaaggccaacacccaacccgacggtagcatctgcgccaagagtcccgatacggcctgc
ctgttgggattggttcgccgtcagtacaaattctcgcccctcaaggacctgatcgcggag
accaacttcgaacaacgcatccccaagcagcaatggtggctgaagctgcgcccactgttg
agaatcctggccaagcacgactccacctacgaggaggaaggcctctacataactgtcgac
gaagagatgtccaccgattcaccggtcgcctaa

DBGET integrated database retrieval system