KEGG   Aedes aegypti (yellow fever mosquito): 5570735Help
Entry
5570735           CDS       T01053                                 

Definition
(RefSeq) elongation factor Tu, mitochondrial
  KO
K02358  elongation factor Tu
Organism
aag  Aedes aegypti (yellow fever mosquito)
Brite
Translation factors [BR:aag03012]
 Eukaryotic Type
  Elongation factors
   5570735
 Prokaryotic Type
   5570735
Mitochondrial biogenesis [BR:aag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    5570735
Exosome [BR:aag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5570735
  Exosomal proteins of breast cancer cells
   5570735
  Exosomal proteins of colorectal cancer cells
   5570735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-GeneID: 5570735
NCBI-ProteinID: XP_001659326
UniProt: Q16YK5
LinkDB All DBs
Position
2
AA seq 463 aa AA seqDB search
MSTYVALRAVLNPVARKTLTQFLFNTGVSWNAARISPTICQKRFYAEKVVFKRDKPHCNV
GTIGHVDHGKTTLTAAITKVLADKDLAESKKYADIDNAPEEKARGITINVAHIEYQTENR
HYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTREHLLLAKQIGVNHIVVFI
NKVDAADQEMVDLVEMEIRELMSEMGFDGDNVPVIKGSALCALEGKSPEIGADAVMKLLE
EVDKYVPTPTRDLDKPFLLPVESVHSIPGRGTVVTGRLERGVVKKGMECEFVGYNKVIKS
TITGVEMFHKILEEAQAGDQLGALVRGIKRDDIKRGMVMCKPGSVKANDNFEAQVYILSK
EEGGRHKPFTSFIQLQMFSRTWDCATQVQIPGKEMVMPGEDAKLHLRLMRPMVIEQGQRF
TLRDGHITLGTGVVTNVLSPLSEKERMSLVEGKKAREKATGKA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtccacctacgtagcgttgcgtgcggttctgaacccagtggctcggaagacactgacc
cagttcctgttcaacaccggtgtcagctggaacgccgctcgcatcagtcccaccatctgc
caaaagcggttctacgccgaaaaggttgtttttaaacgagacaagccccattgcaacgtc
ggaacgattggccatgtcgatcacggtaagacaaccctgacggccgctatcaccaaagtc
ctcgccgataaggatctggccgaaagcaagaagtacgctgacattgacaacgccccggaa
gagaaagcgagaggaatcactattaacgtagctcatattgagtaccagacggagaatcgg
cactacggtcatacggactgtcccggccatgccgattacattaagaacatgatcaccgga
acggcccaaatggacggagctatcctggtggtggcagctactgacggtgctatgccccaa
accagggaacatttgctgctggccaaacagattggggtcaatcacattgtggtcttcatt
aacaaagtggacgcggccgatcaggaaatggtagatctggtggaaatggaaatccgcgaa
ctgatgtccgaaatgggcttcgatggggacaatgttcccgtcattaagggatcggccttg
tgtgctttggagggcaagagtccggaaattggtgccgatgcggtgatgaagctgctagag
gaggtggacaaatacgttccgaccccgactcgggatctggataagcctttcttgctgccg
gtggagtcggtgcacagcatccccggacgaggtaccgttgtgaccggacgtttggagcgc
ggcgtcgtgaagaagggcatggaatgcgagttcgttggttacaacaaggtcatcaaatcg
acaatcaccggcgtcgaaatgttccacaaaattctggaggaagcccaggccggcgatcag
ctgggcgccctggtgcgtggtatcaaacgtgacgacatcaagcgcggcatggtcatgtgc
aagccgggttcggtcaaggccaacgacaacttcgaggcgcaggtttacattctgagcaag
gaggaaggcggacgccacaagcccttcaccagcttcatccagctgcagatgttctcgcgc
acgtgggattgtgccacccaggtgcaaattcccggcaaggagatggtcatgcccggtgag
gatgccaagctgcatctgcgtctgatgaggcccatggtcattgagcagggacaacgtttc
acactgcgcgatggacacattacgctgggaaccggtgtcgtcaccaatgtgctctcgcca
cttagcgaaaaggaacgaatgtcgctggtcgagggcaagaaggcacgagagaaggccacc
ggaaaggcctaa

DBGET integrated database retrieval system