KEGG   Aedes aegypti (yellow fever mosquito): 5571124
Entry
5571124           CDS       T01053                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein
  KO
K20017  Bcl-2 family protein
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag04214  Apoptosis - fly
aag04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:aag00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    5571124
   04215 Apoptosis - multiple species
    5571124
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 5571124
NCBI-ProteinID: XP_021711034
LinkDB
Position
3
AA seq 298 aa
MLSAEAPVSHNHHLLPDRLSAPALARRKFSFPANLHSTVLHGDPPGSINSGSLQPSSTAS
FARRRLSNVSDVVTRKLSSTIGWKQPVLPSQDIITQGKCLCGQYIRCRLKKSGVFNRKLG
LQRIRSIVGTPTIHVVREVFPALLSVGEELERMYPRVYNGVARQLSRIGRGELKTPETAP
VLLSAIARDLFRSDITWGKVVSLFAIAGGLSVDCVRQGHPDYLPKLIEGVADVIEDELVT
WISENGGWVGLANKVRPPQEEITFAGRCFVGAGLLVCLFIFVFLLKALGLYMFPNIFT
NT seq 897 nt   +upstreamnt  +downstreamnt
atgctgtcagccgaagcccctgtcagccataaccatcacctgctaccggatcggttgagt
gcacctgccttagcgcgacgaaagttcagcttcccagccaacctccactcaacggttcta
catggggatcctcccgggtccatcaattcgggatctctgcaaccatccagcacagcatcg
tttgcacggcgacgactgagtaatgtaagcgacgtagtcactaggaaactgtctagcaca
ataggatggaagcaaccggtgctgccatcacaagacataataacacaaggaaaatgcctc
tgcggccagtacatacgttgccggctgaaaaagtccggtgtgttcaataggaaacttgga
ctgcaaagaataagaagtattgtcgggacaccgaccatccacgtagtgcgcgaagtattt
ccagcgttgttaagcgttggcgaagagctcgaacgaatgtatcctcgggtttacaacggg
gtagctcgtcaacttagtcggatcgggcgaggcgaactgaagacgcccgaaacagctccc
gtactgctgagcgcaatagcgagggacttgttccggagcgatatcacgtggggtaaagtg
gtctcgttgtttgccattgctggaggcctctcggtggattgcgtacgccagggccacccg
gactatctgccaaagctgatcgaaggggtagccgacgtcattgaagatgaactcgtcaca
tggatttcggagaatggaggctgggttgggttagcgaacaaagtacgtcctccacaggag
gagatcacttttgcaggacgttgttttgttggagctggattgttagtttgtttatttatt
tttgtgtttttgttgaaagcattaggattatacatgtttccaaatatatttacatag

DBGET integrated database retrieval system