KEGG   Aedes aegypti (yellow fever mosquito): 5571858
Entry
5571858           CDS       T01053                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00230  Purine metabolism
aag01100  Metabolic pathways
aag04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5571858
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    5571858
Enzymes [BR:aag01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     5571858
SSDB
Motif
Pfam: Guanylate_cyc AC_N
Other DBs
NCBI-GeneID: 5571858
NCBI-ProteinID: XP_021702924
LinkDB
Position
2
AA seq 944 aa
MLIEEQSAEQERLLLSVLPEHVAVKMRQDLGSTNSEQFKKIYMSRHENVSILYADIVGFT
AISSTYSAQDLVKILNELFARFDRLAEKYQQLRIKILGDCYYCISGAPVERPDHAVLCVH
MGLSMVKAIKYVQQKTNSPVDMRVGIHTGAVLAGILGQRQWQFDVYSKDVELANKMESSG
KAGRVHLSEKTLSFLNGEFEVEPAYGEKREEALRIAGLKTYFITKVLKPFCPAEHRMNGS
ADPKDVVIEPDGPSEVFRDDEEPKTPANDVEANAGLDQKEKEMAAEDYKVRLRKELVSRD
GHREIYKDINALLWFKNGDIEQAYTQYRQPHSSIPLLAAIVVQFAGMIFSYLVLPRTTLH
FDIVTPPLVIIFILVFISVAESFPKILPAFITLNSKRFNDCVGLRTSTAVIIVLLLGISN
AGDMLAASVRTPLHLNVTNASFLSSEMHPSTICLFPSYFSNFTVLILVAVSIITQLSHLS
KIALMVAIAAIHCYINIFHLDEAFRNEDFEIMNVFPLRYTLSALLMAVTIALSLLARHID
KVDRVIFMWKTEVSDQKERASDMRRRNEALVYNVLPMHVAEHFMGNRKRSHDDLYSQSYA
EVGVLFASMPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLELPQFQDVIKIKTIGST
YMAASGLNPSRIVKPEDPISVRWAHLALLVEFALELKKALQGINEQSFNHFVLKMGVNHG
PITAGVIGARKPHYDIWGNTVNVASRMESTGKAGAIQVTEETCQILQTFGYTFEQRGLVA
VKGKGQLMTYYLQGKIPKNASPILPVTTMETVQEVDEPKESPPALPTESPAHQITSVSSS
TTSPNSVRLNQEYVEMKVSSTSNTITSNENHRQQAADLQQLNSTTNTTVVSAAEQKSEGG
GVKILFNGETEEADVKTPLLDDKNSTNANHFSEGEKDALIENSN
NT seq 2835 nt   +upstreamnt  +downstreamnt
atgctgatcgaggaacaatcagccgagcaggaacgattacttctctcggtactgccggag
cacgtcgcggtgaaaatgcgacaagatctgggatccaccaactcggagcagttcaaaaaa
atctacatgagtcgccacgaaaatgtcagtattctgtatgctgatatagttggctttacc
gccatctcatcgacctactcggcccaggatctggtgaaaattttaaacgaacttttcgca
cgatttgatcgtctggcagagaaataccagcaattaaggataaagatcctgggcgattgc
tactactgcatcagtggagctcccgtagaacgaccggatcacgccgtcctttgcgtccac
atgggtttgtcgatggtgaaggctatcaaatacgtccagcagaagacaaattctcccgtt
gacatgcgagtgggaatccacacgggagctgtcctggcgggaatcctcggtcaacgccag
tggcagttcgacgtgtattccaaggatgtcgagctggccaacaagatggaatccagcggc
aaagccggccgcgttcacttgtcggaaaaaacgttgagcttcctgaacggggaattcgag
gtggaaccggcgtacggcgagaaacgggaggaagcactgcggatagccgggctaaagacg
tactttattaccaaagtattaaaaccgttctgtcccgccgagcaccgaatgaacggctcc
gcagatcccaaggatgtcgttatcgaaccggatgggccgtcggaagtgtttcgcgatgac
gaagaacccaagacaccggcaaacgatgtcgaggccaatgccgggctggaccagaaggag
aaggaaatggccgccgaagactacaaggtgcgactccggaaggagttggtcagccgcgat
ggccatcgggaaatctacaaggacatcaatgcgctgctgtggttcaagaacggcgacatc
gagcaggcctacacacagtaccgacagccgcacagctccatcccgctgctggcggcaata
gttgtgcagttcgctgggatgattttctcctacctggtgcttccgcgtacaacgctacac
ttcgatatcgtcaccccaccgctagtgattatctttatcttggtctttatatcggtagca
gaaagctttccaaagattctgccggcgtttatcacgttgaacagtaaacggtttaacgat
tgtgtcggcttacgcacatcaacggccgtgattatcgtgctgcttttaggaatatctaat
gctggcgatatgctggcagcttccgtgcggaccccgctgcacctgaacgtcaccaacgcg
tccttcctgtcgagcgaaatgcacccgtcaaccatttgtttgtttccgtcgtacttcagc
aactttaccgttctgatcttggtggccgtttccattatcactcagctgtcgcatctgagc
aaaattgcattaatggtcgccattgccgctattcactgttatatcaacatatttcacctg
gatgaagcgttccgaaacgaggatttcgagataatgaatgtatttcccttgcgatatacc
ctgtcggcgttgctgatggcagtgacgatagcactttcgctcctggcgcggcatatcgat
aaggtggaccgggtaatattcatgtggaaaacggaagtcagcgaccaaaaggaacgggcc
agtgacatgcgccggcgtaacgaggccctggtctacaatgtgcttccgatgcatgtggca
gagcatttcatgggcaaccggaagcgatcccacgacgatttgtactcgcagagttacgca
gaggtgggagtgctgtttgccagcatgcccaacttttccgacttttactcggaggaaacg
gtcaacaaccaagggttggagtgtttgcgtttcctgaacgaggttatatcggactttgat
gcgcttctcgagttgcctcaattccaagatgttatcaaaatcaagacaatcgggtcgact
tacatggcggcaagtggactgaacccatcgcggatcgttaaaccggaggatcccatttcg
gtccgatgggcgcatttggcactgctggtcgagtttgctctggagcttaagaaggctctg
caaggaatcaacgaacaatcattcaaccattttgttctgaagatgggagtcaatcatggt
ccaataacggcaggtgtcatcggtgcacggaagccacactacgacatctggggcaatact
gtgaacgtggcgtctcggatggagagtactggaaaagctggagccattcaggtcacggaa
gaaacctgccaaatcctgcaaaccttcggctacacattcgagcagcgagggttggtggcc
gtgaaaggcaagggccaactgatgacgtattacctgcagggaaaaatcccgaaaaatgct
tcccccatcctgccggtaaccacgatggaaaccgttcaggaagtggacgaacccaaagaa
tctccaccggcgcttccaacggaatcccctgctcaccaaatcacgtcggtctcttccagc
accaccagccccaacagcgttcgcctaaatcaggaatacgtcgagatgaaggtaagcagt
acatcgaatacgataacttcgaacgaaaaccaccggcaacaggctgcagacctgcagcag
ttgaacagtactactaatactactgtggtcagtgcggcggagcagaagtcggagggcggc
ggggtgaaaatactattcaacggggaaaccgaagaggcggatgtgaaaacgccactcctc
gacgataagaacagcacaaatgcgaaccactttagcgagggcgaaaaggatgcactaata
gagaatagcaattag

DBGET integrated database retrieval system