KEGG   Aedes aegypti (yellow fever mosquito): 5573490Help
Entry
5573490           CDS       T01053                                 

Definition
(RefSeq) maltase 1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00052  Galactose metabolism
aag00500  Starch and sucrose metabolism
aag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    5573490
   00500 Starch and sucrose metabolism
    5573490
Enzymes [BR:aag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     5573490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase DUF4635
Motif
Other DBs
NCBI-GeneID: 5573490
NCBI-ProteinID: XP_001660908
UniProt: Q16SN5
LinkDB All DBs
Position
2
AA seq 607 aa AA seqDB search
MISLRVPLLLLVATAVLLATAQDSDQKEWWETTVFYQIYPRSFFDSNDDGTGDIKGITAK
LQHLKDTGFEATWLSPIFQSPQEDFGYDVSDFVSVDPLFGSNSDLEELFAEAEKLGIKII
LDFVPNHSSNEHEWFVKSENRVDPYTDYYMWHNGKPNPQGGRPLPPNNWQSVFYGSAWEW
SEKRQQYYLHQFAVGQPDLNYRNEAVIKEFDEILRYWMKKGASGFRIDAINHMFEVEDLR
DEPINDPSDPNSYGYTHHIYTKDLPDTYEVIARWRKVIDDYVKESDSDTIIMMTEAYANL
TMTMKFYESDDGTQPRAHFPFNFAMIEDLNDGSKASNFKYIIDRWLDNMPRGKITNWVLG
NHDKPRMASRYGRDRIDGMALILMTLPGVAVVYNGEEIGMEDYRDMSYEDSKDPQGCNLG
PDNYKWASRDPQRTPFQWDDSFNAGFSKAAKTWLPMHPLYRQTNLLKQTEADYSTYHFYV
DCMKLRKERILTHGEFRSRAFNDDVFAFVRFLRENEDRELDPYYVTLVNFHGETYTVDVT
ELYRFAGKTATVRLVGTDSRHKVGQTVNTTELTLGPYEAIVIGASSAVSVHLSMALLVTA
IIKYLFL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgataagtcttagggtacccttgttgctgctagtggcgacggccgtccttctcgcgacg
gcacaagattccgaccagaaggaatggtgggaaacgaccgttttctatcagatctacccg
aggtcgttcttcgattcaaatgacgatggcaccggtgacataaaaggaatcacagccaag
ctgcagcatcttaaggataccggcttcgaggcaacgtggctcagtccgattttccagtcg
ccccaggaagactttggatacgatgtgagtgacttcgtttcggtggatccactatttggc
tctaacagtgatctggaggagctgtttgccgaagccgaaaagctcggaatcaagataatt
ctggatttcgtgcccaaccattcgagtaatgagcatgaatggttcgtgaagtctgaaaat
agggtagacccctataccgattactacatgtggcacaacggaaaaccgaatccgcaaggt
ggaagacctttgccgcctaataattggcaatcggtattctacggatccgcatgggagtgg
agtgaaaagcgtcagcagtattacttgcatcagtttgctgttggtcaaccggatttgaac
taccgcaatgaggctgtgatcaaggagtttgatgaaattttgcgctactggatgaagaaa
ggagcatcgggcttccgcattgatgccatcaaccatatgttcgaggtggaggatttacgg
gatgaaccgattaacgatccgtcggaccccaacagctacggttatacgcatcacatctac
acgaaagatcttccggatacgtacgaggtaattgcccgctggcgtaaggtcatcgacgac
tacgtaaaggaaagtgattccgatactatcatcatgatgactgaagcgtacgccaatttg
actatgaccatgaagttctacgagtccgatgatggtacgcaaccaagggctcatttcccg
ttcaactttgcaatgattgaggacttgaacgacggctcaaaagcatcgaattttaagtac
attattgaccgctggctggacaacatgcctcgaggaaagatcaccaactgggtgttggga
aaccacgataagccccgcatggccagtcgctacgggcgggaccgtatcgatggaatggct
ttgattctgatgactcttccaggggtggcagttgtgtacaatggagaggaaatcggtatg
gaagactatcgtgacatgtcttatgaagatagcaaagatccccaaggatgtaacctgggc
ccggataactacaaatgggcatcgagagaccctcagcgaactccgttccaatgggacgac
agctttaacgcaggattctcaaaggccgctaaaacatggcttccgatgcatccgctgtac
agacaaacgaacttgctgaagcaaacggaagctgattacagcacctatcacttctacgtg
gactgcatgaagcttcgaaaggaacgcattttgactcatggagaattccgctcccgagcg
ttcaacgacgacgtgtttgccttcgtgcgattcctgcgggaaaatgaagatcgtgaactg
gacccatactacgtaacgctggtcaacttccatggggaaacctacaccgtggatgtgacc
gagttgtaccgattcgctggaaaaaccgcaaccgtcagactggttggtaccgattcacgt
cacaaagttggtcaaaccgtcaacactacggagctgactctgggtccgtacgaagccatt
gtaatcggtgctagttcagcagttagcgttcatctgtcgatggcattacttgtgacagct
ataattaaatatttgttcctatga

DBGET integrated database retrieval system