KEGG   Aedes aegypti (yellow fever mosquito): 5575223Help
Entry
5575223           CDS       T01053                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag00020  Citrate cycle (TCA cycle)
aag00190  Oxidative phosphorylation
aag01100  Metabolic pathways
aag01200  Carbon metabolism
Module
aag_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aag_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aag_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:aag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    5575223
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    5575223
Enzymes [BR:aag01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     5575223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 5575223
NCBI-ProteinID: XP_021710179
LinkDB All DBs
Position
3
AA seq 658 aa AA seqDB search
MLRLPSLMAKSALSAARGLSAATSTQRGLHFTVGQNNAKTNPGAISKEYPVVDHTYDAVV
VGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEEDDWKWHMYDT
VKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTPDGKIYQRAFGGQSLKYGKGGQA
HRCCCVADRTGHSLLHTLYGQSLSYDCNYFIEYFALDLLMENGHCVGVIALNLEDGSIHR
FRSKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVARAGLPSEDLEFVQFHPTGIYGAGCL
ITEGCRGEGGYLINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDHVYL
QLHHLPPEQLAQRLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYKGQVLTVDS
SGNDHVVPGLYACGESACSSVHGANRLGANSLLDLVVFGRACAKTIAAENRPGEKIADIK
PNAGEASVANLDWVRNANGAVPTSTLRLNMQKTMQTHAAVFREEKTLQEGVRKMADIYKT
IKDVKVSDRSLVWNSDLVETLELQNLLLNANMTITAAENRKESRGAHAREDYKHRVDEYD
YSKPLEGQQKKPVEEHWRKHTLTWIDPETGAVKIDYRPVIDQTLSEECNTVPPAIRSY
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgattgccatcgctaatggccaagagcgccctgtccgcggctcgcggactgtcg
gccgccacgtcaacgcagcgcggattgcatttcaccgtcggccagaacaatgccaaaacg
aacccgggtgccatctcgaaggaatacccggtggtagatcacacgtacgatgccgtggtg
gtcggtgccggcggggccggtctccgtgccgccttcggtctggtggccgaaggcttcaaa
acggccgtcattacgaaactgttcccaacccggtcgcacaccgtagcggcccagggtgga
atcaacgcagctctggggaacatggaagaggacgactggaagtggcacatgtacgatacg
gtgaaagggtcggattggctgggagatcaagacgccatccactacatgacccgcgaagcc
ccgaaggccgtcatcgagctggagaactacggtatgccgttttcgcgtacccctgacggt
aaaatctaccagcgggcgttcggtggacagagcttgaagtacggaaaaggtggccaggct
catcgttgctgctgcgtggccgatcgaactggacattctctgttgcatacgttgtatggc
caatcgttgagctacgattgcaactacttcatcgaatactttgccctggatttgctgatg
gaaaacggacattgcgtcggagtgattgctctgaacttggaagacggtagtatccaccgt
ttccgatccaagaacaccgtgctggccactggaggatatggtcgtgcctacttctcgtgt
acctcggctcacacctgtaccggcgatggaactgctatggttgctcgcgctggactgcct
tcggaggatttggaatttgttcagttccatccgactggaatctacggcgctggttgcctc
atcactgaaggttgccgcggtgaaggtggttacttgatcaactcccaaggcgaacgattc
atggaacgttatgccccagtggccaaggatttggcatcccgtgatgtcgtgtcccgttcg
atgaccatcgaaatccgtgaaggtcgcggctgtggccctgaaaaggaccatgtctacctc
cagctgcaccatctgcccccagagcagctggcccagcgtctgcctggtatctccgaaact
gctatgatctttgctggagtcgatgtgacccgtgaaccgattcctgtcctaccaactgtg
cattacaatatgggcggagtccccaccaactataagggccaagttctgaccgttgactcc
agcggtaacgatcacgttgttcccggattgtatgcttgcggagaatctgcatgctcgtcg
gttcatggcgctaacagactgggtgctaactccctgctggatttggttgtctttggtcgt
gcctgtgccaagaccatcgctgcggagaatcgtcccggagaaaagattgccgacatcaag
ccgaacgccggtgaagcatcggttgccaacttggattgggttcgcaatgccaacggagct
gttcctacctcgaccctgcgactgaacatgcagaagaccatgcagacccatgctgcggtg
ttccgcgaggagaagacactgcaggagggtgtccgcaagatggccgacatctacaagacc
atcaaggacgttaaggtttcggaccggtcgctggtgtggaactcggatctggtggaaacg
ttggaactgcagaacctgttgctgaacgccaacatgaccatcacggccgctgagaaccga
aaggaatcgcgtggtgctcatgcccgcgaggattacaagcaccgcgtggacgaatacgac
tacagcaaacccctggaaggccagcagaagaagccagttgaagagcactggcgcaaacac
acgctgacctggatcgatccggagacgggtgccgtcaaaattgactaccgaccggtcatt
gatcagaccctgagcgaggaatgcaacaccgtgccaccggccatccgttcgtactaa

DBGET integrated database retrieval system