KEGG   Aedes aegypti (yellow fever mosquito): 5576502Help
Entry
5576502           CDS       T01053                                 

Definition
(RefSeq) tyrosine-protein kinase hopscotch
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
aag  Aedes aegypti (yellow fever mosquito)
Pathway
aag04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:aag00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    5576502
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aag01001]
    5576502
Enzymes [BR:aag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     5576502
Protein kinases [BR:aag01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   5576502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 Kinase-like RIO1 Jak1_Phl Pkinase_fungal FERM_F1
Motif
Other DBs
NCBI-GeneID: 5576502
NCBI-ProteinID: XP_001662694
UniProt: Q16LR4
LinkDB All DBs
Position
2
AA seq 1135 aa AA seqDB search
MSEHENKYQVYIYLKECFIDVPAREGDTCEDLCTSLCQRYGIGPLVQLLLGLRIHDEPWF
LAPSARPQAGKKYDFRVRFKIPKLSNLKTLDRALFNYYYYQLRHDLLQSKIGEIENDEYK
NKILGYVVNDMYRKMVEDGVSVTELQRTYKEYIPRKISKEHSFLFFNPARNKVLDSLKQI
CRKDHDVDYVKSVYINDIDNIAPCYLYEEYDCSIPYPRDDGITKPGKCKVKVKFVPYARS
RTVGKNAQKDDSESLPGLKVLYSQEWRHVANIDEIFTILVRNQLTVDISLKDQQNLYSID
FSSQTELESFVTCLAGYYRLMCKWTVYLCKPHLSSPTLNRLTELKCHGPIGGKYSYRKIT
EKNSSVGANIVRQCENHYDTYYVDILERENQMKTYKLTYLENRWHVHRAPGEVTAYDELL
DALRNLNPKIKNLYRLSPTEHDKAPNLLLCQPENDMTSKKLLRDAGEMQQVRPQIVNAAK
ELAIKRNALKNEGDGFFERTRAELFLPNNTKMEVTLKLLKNEKKDEFLSDFLQLADLWAS
IDCRNIIKLYGVALFKPVAMVLESSRDGPLDEFLRQHRKVPFSSLIDVAHSLACALYYLQ
EKGLVHGRIRCSSMLVTSYERSENRLIAKLGDPGLRQRHQYTDRDLLWIPIEYHDLGQNE
VQLLKRDLKADIWACSTTLWEIFSRGKGSSPRNVKEFIASGRRLEAPAECKHIKEIYQCM
FYGWVVDPDKRFAPQMIISKLVQAKQRKEYCEIPQTGILNGTTNSANGSYSHQSINSIDT
DSTFLNSRTDVSHSSYVSNGSDGDAGSNASSECSSQPLISNGGSSHYSTGSNSGWGQAQA
ENFLYDCPDFIELSNGSKVIFQGELGQGHYGKVYCGCIDDGVNQIQVALKTIYPISPLDA
EIAKTDFKREVSIMKKLNHRNIVKLIDFIDEIDKLVVIMEFMEKGSLLDFVSYNCHNLTK
LNLLRFSRDIANGMNHLFEKKIIHRDLAARNILVQSMDCVKISDFGLAQVTDGGNYYIAQ
NSRDLPIKWYSPETLKTMKYSFKSDVWSFGVTLFEMFTYGETPFPELEIRDAEQLFDLLT
VQRIRLQLTDRDRDVQEQLMDPCFILDSHQRPSFVQLFENIEQLIDQYGESIQLF
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcatgagaacaaatatcaggtgtatatctatctgaaggaatgcttcatcgac
gtcccggctcgggagggcgatacctgcgaggatctgtgcaccagtctctgccagcggtac
ggcattggtccgttggtgcagctgctgttgggccttcgaatacacgacgaaccatggttc
ctggcaccgagtgcccggccacaagccggcaaaaagtacgactttcgcgtacggttcaag
attcccaagctttccaatctgaagacgctggatcgggccctgttcaactactactactac
cagctgcggcacgatctcttgcagagcaagatcggcgaaatcgagaacgacgagtacaag
aacaaaatcctgggctacgtcgtcaacgacatgtaccgcaagatggtcgaggatggcgtc
agcgtaaccgagctgcagcgcacctacaaggagtacatcccgcggaagatcagcaaggag
cactcgtttctgttcttcaacccggcccggaacaaggtgctggactcgttgaagcagatc
tgccgcaaagaccacgacgtggactatgtaaaaagtgtgtatataaacgatatcgataac
attgcgccctgctatctgtacgaggaatacgactgcagcataccgtatccgcgggacgat
ggcataacaaagccgggaaagtgtaaggtcaaggtgaaattcgtaccctacgcacgcagc
cggaccgtgggcaaaaacgcgcaaaaggacgacagcgaatcgctgccaggactgaaggtg
ctatattcgcaagagtggaggcacgtagcgaatatcgatgaaatttttactatactagta
cgcaaccaactaacggtggacatttcactgaaggatcagcagaatctgtactcgatagac
tttagcagtcagactgaattagaatcgttcgtaacgtgtttagctggttattataggtta
atgtgtaagtggactgtgtatctttgtaaaccccatctgtcctcaccaacattgaatagg
ctaacggaacttaaatgccatggtcctatcggaggaaagtactcctaccggaaaataacg
gagaagaatagcagtgtcggggctaatattgttcgtcaatgcgaaaaccactacgacacg
tactacgtggacattttagagcgcgagaaccaaatgaaaacttataagctcacctacctg
gagaatcgttggcatgtgcatcgtgcaccgggcgaagtaacagcgtacgacgaactgctc
gacgccctgcgcaatttgaatcccaagatcaagaatctgtaccggttgtcgccgacggag
cacgacaaggcgccgaatctcctgctgtgccagccagagaacgacatgacgtccaagaag
ctgctccgggatgccggggaaatgcaacaggtccgtccgcaaattgtgaacgcagccaag
gaactggccatcaagagaaatgctttgaagaatgaaggtgatgggttctttgaaaggaca
agagctgagctctttctgccgaataataccaaaatggaagtcactctgaagctgctcaag
aacgaaaagaaagacgaatttttgagtgattttcttcaattggcggatttgtgggcgagt
atagactgcagaaacatcataaagctgtacggcgttgcactgttcaaacctgttgcaatg
gtgcttgaaagttcccgggatggtcccctagatgagtttctgcgccagcataggaaagtt
cccttttcgtcactgatcgatgtggcccattcattggcctgtgctctctactatctacaa
gagaagggactcgtgcatggacggatacgatgttcatcgatgctggtaacgtcatacgag
cgaagcgagaaccgcttgatagccaaactgggcgatccgggattgcgccagcggcatcaa
tatacggatagggatttgttgtggataccgatcgagtaccacgacctgggacaaaatgag
gtgcaattgttgaaacgggacctgaaggcggatatttgggcctgttcgacgactttgtgg
gagatttttagccgtgggaaaggttcatcacctaggaatgtcaaggagtttatcgcttcc
gggcggagattggaagcaccagcggaatgcaaacacataaaggagatctatcagtgcatg
ttttacggctgggtggttgacccggataaaagattcgcccctcagatgattatttcgaag
ttggtgcaagcaaaacaaaggaaggaatattgcgagataccccaaactggtatattgaat
ggaacaaccaattcagcgaatggatcctactcgcaccagagtattaactccatcgatact
gattccactttcctaaactcgcgaacggacgtttcccactcgtcgtacgtgagtaatggc
agcgatggcgacgctggtagtaatgcttcgagtgagtgcagctcgcagccactcatatcg
aacggtggttctagtcattacagcaccggctccaacagtggatggggacaggcacaggcc
gaaaacttcctgtatgactgtccggactttatcgagctgtccaacgggtcgaaggtgata
ttccagggggaactgggtcaaggtcactacggcaaggtttactgcgggtgcatcgacgac
ggagtgaaccagatacaggttgctctgaagactatctacccaatcagtccgctggatgcg
gagatagcaaagactgacttcaagcgggaggtttccatcatgaaaaagctcaaccatcgg
aatatcgtcaagctgatcgacttcatcgacgagattgacaaactggttgtgatcatggag
ttcatggagaaaggctcactgctggattttgtgagctacaactgtcacaatctaactaaa
ctgaatttgctgcgattttctagggatattgctaatggaatgaaccacctgttcgagaag
aaaatcatccatcgggacttggcggcgcggaacatcctggtgcagagtatggactgtgtg
aaaatctccgatttcggtttggcccaggtcaccgatggcggtaactactacatagcgcaa
aatagccgcgatttgccgatcaagtggtactcgccggagacgctgaagaccatgaagtac
tccttcaagtcggacgtgtggtcgtttggggtgacactgttcgagatgttcacgtacggc
gagacgccgttcccggagctggaaattcgcgacgcggaacagctgttcgacttactgacg
gttcaaagaatcagactgcaactcaccgaccgagatcgggacgtccaggagcagctgatg
gatccttgtttcatcctggactctcatcagcgcccatcgtttgtgcaattattcgagaat
atcgaacaacttatcgaccaatatggcgaatcaattcaacttttctaa

DBGET integrated database retrieval system