KEGG   Aggregatibacter actinomycetemcomitans HK1651: CF65_00007Help
Entry
CF65_00007        CDS       T03184                                 

Definition
(GenBank) superoxide dismutase [cu-zn], putative
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aah  Aggregatibacter actinomycetemcomitans HK1651
Brite
Enzymes [BR:aah01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CF65_00007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AHN70688
UniProt: X2JLD5
LinkDB All DBs
Position
4543..5118
Genome map
AA seq 191 aa AA seqDB search
MKIKTILAIVIGTICSAGIANAHEHKHDNMMMPLKGPSIEVKIQQLDPVNGNKDVGTVTI
TESSYGLVFTPNLKGLAEGLHGFHIHQNPSCEPKEKDGKLTAGLGAGGHWDPKDTKQHGY
PWQDDAHLGDLPALTVLHDGTAANPVLAPRIKHLDDVRGHSLMIHAGGDNHSDHPAPLGG
GGPRMACGVIK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaactattttagccatagtaatcggcacaatctgttctgcaggcattgct
aatgctcatgaacataagcatgacaacatgatgatgcctcttaaaggaccatctattgaa
gttaaaatacagcaattagatccggtcaacggcaacaaagatgtgggtacggtcactatc
accgaatccagctacggcttggtattcaccccaaatttaaaaggcttggcggaaggtttg
cacggtttccacattcaccaaaacccaagctgtgaaccaaaagaaaaagacggcaaactt
accgcaggtcttggcgcaggcggtcactgggatccgaaagacaccaaacaacacggctac
ccatggcaagatgacgcccatttaggtgatttaccggcattaaccgtattacacgacggc
acagccgctaacccggttttagccccacgcattaaacacttagacgacgtgcgcggtcac
tccctcatgatccacgctggtggcgataaccactccgatcacccggccccacttggcggc
ggcggtccgcgtatggcgtgtggtgtaattaaataa

DBGET integrated database retrieval system