KEGG   Aggregatibacter actinomycetemcomitans HK1651: CF65_02047
Entry
CF65_02047        CDS       T03184                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase,putative'
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
aah  Aggregatibacter actinomycetemcomitans HK1651
Pathway
aah00052  Galactose metabolism
aah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CF65_02047
Enzymes [BR:aah01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     CF65_02047
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Pyr_redox_2 Pyr_redox Methyltransf_31 UDPG_MGDP_dh_N Shikimate_DH 3HCDH_N 2-Hacid_dh_C TrkA_N FAD_binding_2 FAD_binding_3 MTS Methyltransf_25 DAO ThiF Sacchrp_dh_NADP ELFV_dehydrog PALP HI0933_like NAD_binding_8 Pyr_redox_3 NAD_binding_7 Methyltransf_11 CoA_binding ADH_N_2
Other DBs
NCBI-ProteinID: AHN72263
UniProt: X2JQI4
LinkDB
Position
1393773..1394816
AA seq 347 aa
MKAVVVEENRKLVLADIAMPKIEDGEDVLVKVLYSGVCGSDIPRIFHHGTHFYPIVLGHE
FCGTVVEIGKSVTEFRKGDLVVCAPLQPCFDCEECHKGYYSLCKNYNFIGSRRFGANAEY
ICVNKKNLVKVSPDSNPLHDAFIEPITVGLHAINLAQGCSDKNVIVVGAGTIGLLAAQCA
EALGAKSVTVIDINDEKLMLAKALGATQTFNSRELAAEEIEKRLLDSRFDQLVLETAGVP
QSVELAIKIAGPRAQVALIGTLHNDLTLNQKVFGLILRKELSILGSWMNYSAPWPGGEWT
KAIELVKQGKIQFDKLIASVNFIEDYITEVKKLDGTPMNGKIVLKFQ
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaagcggttgttgttgaagaaaacagaaaattggtgctggcggacattgcgatgccg
aaaatcgaagatggggaagacgtgctggtaaaagtactgtattcgggggtatgcggttcc
gatattccgcgcatatttcaccatggcacgcatttttaccccatcgtactagggcacgaa
ttttgtggtacggtagtggaaatagggaaaagcgtgacggaattccgcaaaggggatttg
gtagtttgcgcaccattacagccttgttttgattgcgaagaatgtcacaaaggatattat
tcattatgtaaaaactacaatttcatcggttcccgtcgcttcggcgccaatgcggaatat
atttgcgtcaacaagaaaaatttggtgaaagtatcaccagattccaaccctttgcatgat
gcttttatcgaacctattacggtgggtctgcacgccattaatctggcgcaggggtgtagc
gataaaaatgtgattgtggtaggagccggtactattggcttgcttgccgcccagtgtgcc
gaagcgctgggtgccaaaagtgtaaccgtcatcgatattaacgatgaaaaattgatgttg
gcgaaagcgttgggtgctacgcaaaccttcaattcccgtgaattagccgcagaagaaatt
gaaaaaagattacttgacagccgttttgaccaactcgtattggaaaccgccggcgttccg
caatcagttgaattagcaataaaaattgcaggtccgcgtgcgcaagtggcattgatcggc
accctacataatgatttaaccctgaatcagaaagtgttcggtttgattttgcgcaaagaa
ttgagcattctcggttcttggatgaattattccgcgccgtggccgggtggtgaatggacg
aaggcaatcgaattggttaaacaaggtaaaattcaattcgacaagctgattgcgtcggta
aatttcattgaagattatattaccgaagttaaaaagcttgacggcacaccgatgaatgga
aaaatagtcttaaaatttcagtaa

DBGET integrated database retrieval system