KEGG   Aggregatibacter actinomycetemcomitans HK1651: CF65_02519Help
Entry
CF65_02519        CDS       T03184                                 

Definition
(GenBank) DNA gyrase, subunit A, putative
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
aah  Aggregatibacter actinomycetemcomitans HK1651
Brite
KEGG Orthology (KO) [BR:aah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aah03032]
    CF65_02519
   03400 DNA repair and recombination proteins [BR:aah03400]
    CF65_02519
Enzymes [BR:aah01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     CF65_02519
DNA replication proteins [BR:aah03032]
 Prokaryotic type
  DNA Topoisomerases
   CF65_02519
DNA repair and recombination proteins [BR:aah03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      CF65_02519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C IKI3
Motif
Other DBs
NCBI-ProteinID: AHN72624
UniProt: X2JUR9
LinkDB All DBs
Position
1750012..1752675
Genome map
AA seq 887 aa AA seqDB search
MSDLIQDITPVSLEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLFAMHEGGNLYN
KPYRKSARIVGDVIGKYHPHGDSAVYDTLVRMAQPFSLRYMLVDGQGNFGSVDGDAPAAM
RYTEARMTKIAHELLADLDKETVNFVPNYDGSEMIPEVLPTKVPALLVNGSSGIAVGMAT
NIPPHNLGEVLDGCLAYIENNDITIDELMSHIPGPDFPTAALINGRKGIEEAYKTGRGKI
YVRARAEIETDEKGRESIIVNEIPYQVNKAKLIEKIADFVKDKKIEGISGLRDESDKDGM
RIVIEIKRDAVGEVVLNNLYALTQMQVTFGINIVALDHGQPKLLNLKQLIEAFVLHRREV
VTRRTIFELRKARERTHILEGLAIALANVDPIIELIRKAPNPENAKRELLTHPWQLGHVA
DMLAASGVDAARPEDLDEQYGIRDGLYYLTEVQAQAILDLRLQKLTNLGHDEILDEYKKL
LDAIGKLLYILRSPERLMEVIREELEQIREQFNDPRRTEITAASGDINLEDLIAQEDVVV
TLSHEGYVKYQPITDYEAQRRGGKGKSATKMKEEDFIEKLLVANTHDTILCFSSRGRLYW
LKVYQLPQASRGARGRPIVNILPLNENERITAILPVAAYEEDKFVVMATAGGIVKKIALT
EFSRPRSSGIIALNLRDEDELIGVDITDGSNEIMLFSSQGRVVRFSESAVRAMGRLATGV
RGIKLALTNDLNDDESAVEIEDVSDDNAEETLDLNIDKVVSLVIPKNNGEILTATQNGYG
KRTKLDEYPTKSRNTKGVISIKVSERNGKVVAAAQVEENDQIMLITDAGTLVRTRVSEVS
IVGRNTQGVRLIRTSEAEHVVSLERICEVDDEESENPTESAVENNEE
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttaatccaagatattacgccggtaagccttgaagaagaattgaaatcttca
taccttgattacgccatgtccgttattgtggggcgcgccctgcccgatgtgcgtgacggc
ttaaaaccggtacaccgccgcgtgttatttgcgatgcatgaagggggcaatctctacaac
aaaccttatcgtaaatccgcccgtatcgtcggtgacgtgatcggtaaataccacccgcac
ggcgacagcgcggtatatgacacgttagtacgtatggcgcagccgttctccttacgttat
atgttggtggacgggcaaggtaactttggttcggtggacggcgacgcgccggcggcaatg
cgttatacggaagcccgtatgaccaaaatcgcccacgaattattggctgatttagacaaa
gaaaccgtcaatttcgtgccaaactacgatggttccgaaatgattcccgaagtgctgccg
accaaagtcccggcgctattggtaaacggttcctccgggattgcagtggggatggcaacc
aacattccgccacacaacttgggcgaagtgttggacggctgtctggcttatatcgaaaat
aacgacattaccattgatgaattaatgagccacattcccggcccggatttcccgacggcg
gcattgatcaacggacgtaaaggcattgaagaagcctataaaaccggacgcggaaaaatt
tacgtacgcgcccgcgcagaaatcgaaaccgatgaaaaaggccgtgaaagcatcatcgtg
aacgaaattccgtatcaagtgaacaaagcgaaactcatcgaaaaaattgccgatttcgtc
aaagacaaaaaaattgaggggatcagcgggttgcgcgatgaatccgacaaagacggtatg
cgcatcgtcatcgaaatcaaacgtgatgcggtcggcgaagtggtgttaaataacctgtat
gcgttgacacaaatgcaagtcactttcgggattaatattgtcgcacttgaccacggtcag
cccaaactattgaatttaaaacagctcattgaggcgttcgtattacaccgccgcgaagtg
gtgacccgtcgtacgatttttgaattacgcaaagcccgtgaacgtacgcacatcttagaa
ggcttggcgattgccttggcaaacgtcgatccgattatcgaattaatccgcaaagcacca
aatccggaaaacgccaaacgtgaattgctcacccatccatggcagctgggtcatgtcgcc
gatatgttggcggcaagcggtgtcgatgccgctcgtccggaagatttggacgaacaatat
ggcattcgtgacggtttatattatttaaccgaagtgcaagcacaagccattttagattta
cgtttgcaaaaattaaccaatttaggtcacgatgaaatcctggacgaatacaaaaaatta
ttggatgccatcggtaaattattgtacatcttgcgtagccctgagcgtttaatggaagtg
attcgtgaagaattggagcaaatccgcgagcaatttaacgatccgcgcagaaccgaaatc
acggcggcttccggtgatataaatctggaagatttgattgcccaagaagatgtggtggtg
accctttcccacgaaggttatgtgaaatatcaaccgattaccgactacgaagcacagcgt
cgtggtggtaaaggtaaatccgcaaccaaaatgaaagaagaagattttatcgaaaaatta
ctggttgccaacacccacgataccattctctgcttctccagccgcggacgtttatactgg
ctgaaagtatatcaactaccgcaagccagccgtggcgcgcgcggacgaccaatcgtgaat
attttgccgttaaatgaaaatgaacggatcaccgctattctaccggtcgccgcctacgag
gaagacaaattcgtcgtcatggcaaccgccggtgggattgtgaagaaaatcgcattaaca
gaattcagccgtccgcgttccagcgggattatcgcccttaacttgcgtgatgaagatgag
ttaatcggcgtggatattaccgacggcagcaatgaaatcatgttgttctcctctcaaggt
cgcgtggtgcgcttcagcgaatccgccgtgcgtgctatggggcgcttggcaacgggtgtg
cgcgggatcaaactcgccttaaccaatgatctgaatgacgacgaaagtgcggtggaaatt
gaagacgtttctgatgataacgcagaagaaaccttggatttaaatatcgacaaagtcgtt
tctttagtcattccgaaaaacaacggcgaaattctcaccgcaacgcagaatggctacggt
aaacggacgaaactggatgagtatccgaccaaatcccgcaacactaaaggggtgatttcc
attaaagtgagtgagcgtaacggcaaagtcgtggcggcggcacaagtggaagaaaacgac
caaatcatgttaatcaccgatgcaggcacccttgttcgcacccgagtaagcgaagtcagc
atcgttggacgtaacacccaaggcgttcgcttaatccgcaccagcgaagcagaacacgtt
gtgagtttagaacgtatctgcgaagtggatgacgaagaaagtgaaaatccgacagaaagt
gcggtagaaaataacgaagaataa

DBGET integrated database retrieval system