KEGG   Glutamicibacter arilaitensis Re117: AARI_17970Help
Entry
AARI_17970        CDS       T01320                                 

Gene name
sdhA
Definition
(GenBank) putative succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00020  Citrate cycle (TCA cycle)
aai00190  Oxidative phosphorylation
aai00650  Butanoate metabolism
aai01100  Metabolic pathways
aai01110  Biosynthesis of secondary metabolites
aai01120  Microbial metabolism in diverse environments
aai01130  Biosynthesis of antibiotics
aai01200  Carbon metabolism
Module
aai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aai_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:aai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AARI_17970 (sdhA)
   00650 Butanoate metabolism
    AARI_17970 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AARI_17970 (sdhA)
Enzymes [BR:aai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AARI_17970 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     AARI_17970 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO FAD_binding_3 HI0933_like Pyr_redox_3 GIDA Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CBT76013
UniProt: E1VWL0
LinkDB All DBs
Position
complement(2039852..2041576)
Genome map
AA seq 574 aa AA seqDB search
MRNEQQISTSVLVIGTGGSGLRAAIELAESGTDVLAVGKRPRHDAHTSLAAGGINAALGT
MDAEDSWQQHAADTIKESYFLADPRTVQVVAQGAARGIEDLERYGMNFAREADGRISQRF
FGAHKFRRTAFAGDYTGLEIQRTLIRRAQQLQVPILDSVYITKLLVAEGRVFGAYGFDVN
DGTGYLIHADAVILAAGGHTRIWRRSSSRRDENTGDAFRLAVEAGARLRDAELVQFHPSG
IIEPESVAGTLVSEAARGEGGILTNALGERFMERYDPQRMELSTRDRVALAAYSEIAAGR
GTAKGGVWLDVSHLPRATIMERLPRVYQTLLEEQMLDITKQKIEIAPTAHYSMGGVQVDP
LTHVTEVPGLYAIGEASSGLHGANRLGGNSLIELLVFGRIVGQGAARYSRALTSQPRSQA
AIEKARGEVDRLLAADGQENVRSLQRAIRDIMTQHAGVVREEAGLKLGLEKLAEVEARMA
RVGIHPDIAGYQDLCHAFDLKSSVLAARATLESALERRETRGCHNRSDYPHTDPQLQVNL
IWSPEGITREPIPEVPGEVAALISEVSQAGKLVE
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatgaacagcaaatatccacctctgttctggtcatcggcaccggcggttccggc
ttgcgcgcggcgatcgaactggcagaatcgggaacagacgtgctggccgtaggcaagcgc
ccgcgccacgacgcacacacctcgctggccgccggcggcatcaacgcagcactgggaacg
atggatgccgaggacagctggcagcagcatgccgctgacaccatcaaggaaagctacttc
ctggccgacccgcgcactgtccaggtggtcgcccaaggtgctgcccgcggcatcgaggac
ttggagcgatacggcatgaacttcgcccgcgaagccgatggccggatctcccaacgtttc
ttcggcgcccacaaattccgccgcacagctttcgccggggactacaccgggctggaaatc
cagcgcaccctgatccgccgggcgcagcaactgcaggtccctatcctggactcggtctac
atcacgaagctgctggtagccgaggggcgggtcttcggcgcctacggcttcgacgtcaac
gatggcaccgggtacctgatccatgccgacgcggtcatcctggccgccggcggccacacc
cgcatctggcggcgcagcagctcgcggcgcgacgagaacaccggcgacgccttccgcctg
gccgtggaagccggtgcccggctgcgcgatgccgagctcgtccaattccacccctcgggc
atcatcgaacccgaatcggtggccgggaccctggtctccgaggcggcccgcggcgaaggc
gggatcctgaccaacgccctgggcgaacgcttcatggagcgctacgatccccagcgcatg
gaactatccacccgcgaccgcgtcgccttggccgcctatagcgaaatcgcggccgggcgc
ggcactgccaagggcggggtgtggctggatgtctcccacctgccccgggccaccatcatg
gaacggctgccccgggtctaccagacgctgctcgaggagcagatgctggacattaccaag
cagaagatcgagatcgccccgacggcgcactattccatgggcggggtgcaggtggacccg
ctcacccacgtaaccgaagtaccgggcctgtacgcgatcggcgaagcctcctcgggcctg
catggagctaatcggctgggcggaaattcgctgatcgagctgctggtcttcggccggatc
gtcgggcagggagctgcccggtattcgcgtgcgctcacttcccagccccgttcgcaggcg
gccatcgagaaggcccgcggggaagtggaccggctgctggccgccgacgggcaggaaaat
gtccggtccctgcagcgggcgatccgcgacatcatgacccagcacgccggagtcgtgcgc
gaggaggcggggctgaagctggggctggagaagcttgcagaggtcgaagcgcggatggcg
cgggtgggcatccacccggacatcgccggctaccaggatctgtgccacgccttcgacctg
aagtcatcggtgctggccgcgcgcgccaccttggagtcagcgttggagcgccgggaaacc
cgcggctgccataaccgcagcgactatccacacaccgatccgcagctgcaggtgaacctc
atttggtcgcccgagggcattacccgtgagccgatccccgaggtgcctggagaagtggcc
gcgctgatttccgaggtatcgcaggcaggcaagctcgtggagtaa

DBGET integrated database retrieval system