KEGG   Glutamicibacter arilaitensis Re117: AARI_24440Help
Entry
AARI_24440        CDS       T01320                                 

Definition
(GenBank) glycosyl hydrolase, family 13
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
aai  Glutamicibacter arilaitensis Re117
Pathway
aai00500  Starch and sucrose metabolism
aai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aai00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AARI_24440
Enzymes [BR:aai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AARI_24440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_20 Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: CBT76664
UniProt: E1VYG1
LinkDB All DBs
Position
complement(2750610..2752319)
Genome map
AA seq 569 aa AA seqDB search
MAALGASLALLAAPLFAAPAQAATPSNDGKDVILNLFQWNWNSVAQECESSIGPAGYGYV
QVSPPAEHLRGTAWWTSYQPVSYKVDSKLGNREEFSAMVKSCNDAGVKVIADAVVNHMTG
AGQTGTGTAGSAFSDDNFPEYSAQDFNDCRTNITNYADRWQVQHCRLVGLQDLKTSSSYV
QQNIADYLDDLVSLGVSGFRIDASKHMPATDLEGIKSKMKNPGVYWVHEVIGASGEPIQE
SEYLGSGDSHEFDYSRQLKHDFDAQIANLRFIGDGKLTSDRAGVFVTNHDTERNGESMNY
KWGAKYLLGNVFMLSWPYGSPTVYSGFAFTDKDAGAPGASDASVPNADCDSSAWTCEQRQ
DEITGMVGFNNAVGDAAVSNWWDDGGNQIAYGRGNKGFVAINNTSAATTREYTSSLAGGT
YCDVVSGGDCSKTITVGADGKFTATLPAYGALALHIGGVSDGGSGTPDPVEDTADVSVAV
TAQTVMGQNIRIVGNQPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFEYKYVKYDQS
GNATWESGANRIATVNADGSLNLNDSWRN
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcactcggcgcctcgctcgccctgctcgccgcaccgttgttcgcagcacccgcc
caagccgccaccccatccaacgacggcaaggatgtcatcctcaacctgttccaatggaac
tggaattcggtagcccaggaatgcgagtccagcatcggcccagcaggatatggctacgtc
caggtctcgcctccagctgagcacctgcgcggcactgcatggtggacctcataccagccg
gtgagctacaaggtggactcgaaactgggcaaccgcgaggaattctccgccatggtcaaa
agctgcaacgacgcaggcgtgaaagtgatcgcagacgccgtggtcaatcacatgaccgga
gccgggcagaccggtactggaaccgcaggctcggctttctccgatgacaacttcccagag
tattcggcccaggacttcaacgattgccgcaccaacatcaccaactatgccgaccgctgg
caagtgcagcactgccgcctcgtgggcttgcaggatctgaaaacctccagcagctacgtc
cagcaaaacatcgccgactatctcgatgacctcgtctcgcttggggtatccggattccgc
atcgatgcctcgaagcacatgcccgcaacggacctcgaaggcatcaaatccaagatgaag
aaccccggcgtgtactgggtgcacgaggtgatcggggcgtcgggtgaaccgatccaggaa
agcgagtacctcggcagcggcgactcgcacgaattcgactactcgcgacagctcaagcat
gatttcgacgcgcaaatcgccaacttgcgcttcatcggcgacggcaagctcaccagtgac
cgggccggggtttttgtcaccaaccacgacaccgaacgcaacggcgaatccatgaactac
aagtggggcgccaagtacctgctgggcaatgttttcatgctgtcctggccctacgggtca
cccaccgtgtattccggattcgcgttcaccgacaaggatgcaggcgctccgggcgccagt
gacgcatcggtacccaatgccgactgcgactcctccgcctggacctgcgaacagcggcaa
gatgaaatcaccggaatggtgggcttcaacaacgccgtcggcgacgcggctgtcagcaat
tggtgggacgatggcggcaaccagatcgcatacggccgcggcaataagggcttcgtagcc
atcaacaacacctcggcggcaaccacccgcgaatacaccagctcgctggccggtggcacc
tattgtgacgtggtgtccggaggcgattgctcgaagaccatcactgtgggcgccgacggc
aagttcaccgcgacactgcctgcctacggtgccttggccctgcacatcggtggcgtatcc
gatggcggatcaggaacgccggatccggtcgaggacaccgctgatgtcagcgtcgcggtc
accgcccaaaccgtcatggggcagaacatccgcatcgtcggcaaccagccggaactaggc
agctgggatccggccaaggcgccacagctatcagctgccagctacccgagctggagcgga
acggtggaccttccggcaggaacgcagttcgaatacaagtacgtcaagtacgaccagagc
ggcaatgccacgtgggaatcaggggccaaccgcatcgcgaccgtgaatgcggacggttcc
ctgaacctgaacgacagctggcgcaattag

DBGET integrated database retrieval system