KEGG   Glutamicibacter arilaitensis Re117: AARI_26870Help
Entry
AARI_26870        CDS       T01320                                 

Definition
(GenBank) putative drug resistance ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
aai  Glutamicibacter arilaitensis Re117
Brite
KEGG Orthology (KO) [BR:aai00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aai02000]
    AARI_26870
Transporters [BR:aai02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    AARI_26870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_23 AAA_30 STAS AAA_15 SbcCD_C AAA AAA_29 AAA_33 DUF3584 MukB
Motif
Other DBs
NCBI-ProteinID: CBT76899
UniProt: E1VZ46
LinkDB All DBs
Position
3013617..3014498
Genome map
AA seq 293 aa AA seqDB search
MLELHHISRSFAEHLVLDDISFTVPSGALTGFVGANGAGKTTTMRIIMGLLSANSGSITL
NGQRLESDTRPNFGYMPEERGLYPKQPVIDQLIYLGQLHGLTRSGARKRSMELLARFGLD
GRAKSKLESLSLGNQQRVQVTASLLHEPDVLILDEPFSGLDPIAVDAMSSILRDYAARGV
PVLFSSHQLDLLDVLVDHLVIIQNGKILANSPADQLRRTQASRHRLSLGSDTGWLRDEPG
VSVIDISGPDALVSFETETDAQRVLATALSRGPVAEFAVHRPSLADIYREIIK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagctacaccatatatcacggtcatttgcagaacatttggtgctcgacgacatc
agcttcactgtccctagcggggcgctgaccggttttgtcggtgccaacggtgccggcaaa
accaccaccatgcgcatcatcatgggtctgctcagcgcaaattccggctcgattacgctc
aacggccagcgcctggagtcagatacccggccgaacttcggatacatgcccgaagagcgc
ggcctgtatcccaagcagccggtgatcgaccagctgatctatctcggacaactgcatggc
ctgacccgttcgggcgcacgcaagcggtccatggaattactggcccgcttcgggctggat
ggccgcgccaaatccaagctcgagtccctatcattgggtaaccagcagcgcgttcaggtc
acggcttccttgctgcatgaacccgatgtgctgatcctcgacgaaccgttcagcggcctc
gacccgatcgcggtagatgcgatgagctcaatcttgcgcgattacgcagcacgtggggtt
ccggtgcttttctcttcgcatcagctggacctgctcgatgtgttggtggatcatctggtg
atcatccagaacggcaaaattcttgccaattcgccagctgatcagcttcgtagaacccag
gcttcacgacaccgcctgtccttgggatccgacactgggtggctgcgcgatgagcccggg
gtcagcgtgattgatatttcgggcccggacgcgctagtgagtttcgaaaccgaaactgat
gcgcagcgcgtgctcgccactgccctcagccgtggtcctgtcgcggagttcgcggtccac
cgcccgtcgctggctgacatctaccgggagatcatcaagtga

DBGET integrated database retrieval system