KEGG   Aeromonas hydrophila MX16A: BOQ57_02680Help
Entry
BOQ57_02680       CDS       T04629                                 

Definition
(GenBank) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
aaj  Aeromonas hydrophila MX16A
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aaj03016]
    BOQ57_02680
Enzymes [BR:aaj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     BOQ57_02680
Transfer RNA biogenesis [BR:aaj03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    BOQ57_02680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB OB_RNB CSD2 S1
Motif
Other DBs
NCBI-ProteinID: APJ13868
LinkDB All DBs
Position
complement(551616..553637)
Genome map
AA seq 673 aa AA seqDB search
MFQDNPLLAQLKQQIRENIPKKEGVIRASDRGFGFLEVDEKTSYFVPPPYMKKVMHGDRV
SALIRTEKEKEVAEPDALLEQSVTRFVARVKMFRDRLNVVADHPLIKDAIKARVKKGLDE
KEFKEGDWVVATLKRHALVDGNFSAEITQKIASQEDHNVPWWVVLARHNLAQVEPADLPE
WKVIEEEELPRTDLTATPFFTIDGAKTKDMDDALAIRKLDNGWELLVAIADPTAYVAEGS
ELDKEAAQRAFTVYMPGRNVPMIPRTLSDELCSLKEGEERNTLCARLLIAEDGLLLEETE
FFAARISSHARLTYDDVSDWAEHGKQLDIDAGVLAQLPLMKAMTEARIKWRTEHALVFPD
RPDYDFELGENGEVLAIHVEPRRIANRMVEESMIAANICAGRVLGKQVGYGIFNVHTGFD
EESLDGAIDLLKSAEAPFEKEEIASLSGFCALRRWIDNLDTRWLDGKIRRFQSYALMSAE
PGAHYGLGLDAYATWTSPIRKYGDMVNHRLLKAVIAGKTPGERPSLELTEHLTACRRLHR
MVERDIGDWLYVRYLKADAGTDKVFNAEIIDVMRAGLKLRLRENGAVVFMPARHILDNKD
RLECNWDNGRVYLDKTEVVYELGQIIEVKLTEAVEETRSLIAKPAVELVPGPAPVAPTSE
ADAAPADEAPKAE
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgttccaagacaatccgctgctggcccagctcaagcaacaaatccgcgaaaacatcccc
aagaaagagggtgtgatccgcgcctccgatcggggcttcggcttcctggaggtcgatgag
aagaccagctatttcgtgccgcctccctacatgaagaaggtgatgcacggtgaccgggtg
agcgccctgatccgtaccgagaaagagaaggaagtggccgagccggatgccctgctggag
cagtccgtcacccgtttcgtggcccgcgtcaagatgttccgcgaccgcctcaacgtggtc
gccgatcacccgttgatcaaggatgccatcaaggcccgcgtcaagaaggggctggacgag
aaagagttcaaggaaggggactgggtggttgccaccctcaagcgtcacgccctggtggac
ggcaacttctctgccgagatcacccagaagatcgcctcgcaggaagatcacaacgtgccc
tggtgggtggtgctggcgcgccacaatctggcccaggtcgagccggcggatctgccggag
tggaaggtgatcgaagaggaagagctgccgcgcaccgatctgaccgcgacccccttcttc
accatcgacggcgccaagaccaaggacatggacgatgccctggccatccgcaagctggac
aacggctgggagctgctggtggccatcgccgacccgaccgcctatgtggccgagggcagc
gagctggacaaggaagccgcccagcgcgccttcaccgtctacatgccgggccgcaacgtg
ccgatgatcccgcgcaccctctccgacgagctctgctccctgaaagagggcgaggagcgc
aacaccctgtgtgcccgtctgctcatcgccgaggacggcctgctgctggaggagaccgag
ttcttcgccgcccgcatcagctcccacgcccgcctcacctatgacgacgtctccgactgg
gccgaacacggcaaacagctggatatcgacgccggcgtgctggcacagctgccgctgatg
aaggcgatgaccgaagcgcgcatcaagtggcgtaccgagcacgccctggtgttcccggat
cgtcccgactacgacttcgagctgggcgagaacggcgaagtgctggccattcacgtcgag
ccgcgccgcatcgccaaccgcatggtggaagagtcgatgatcgccgccaacatctgtgct
ggccgcgtgctcggcaagcaggtcggctacggcatcttcaacgtccacaccggctttgac
gaagagtccctcgacggcgccatcgatctgctgaaaagcgccgaggccccgttcgagaaa
gaagagatcgccagcctgtccggcttctgtgccctgcgccgctggatcgacaatctggac
acccgctggctggacggcaagatccgccgcttccagagctatgcgctgatgtccgccgag
ccgggcgcccactacggcctggggctggatgcctacgccacctggacctcaccgatccgc
aaatacggcgacatggtcaaccatcgcctgctgaaagccgtcatcgccggcaagacaccg
ggtgagcgcccgagcctggagctcaccgaacacctgaccgcctgccgtcgtctgcaccgc
atggtggagcgcgacatcggcgactggctctatgtccgctacctcaaggccgatgccggc
accgacaaggtgttcaacgccgagatcatcgacgtgatgcgcgccggcctcaagctgcgt
ctgcgcgagaacggcgccgtggtgttcatgcccgcccgccatatcctcgacaacaaggat
cggctggagtgcaactgggacaacggccgcgtctatctggacaagaccgaggtggtctac
gagctcggccagatcatcgaggtcaagttgaccgaagcggtggaagagacccgctccctc
atcgccaagccggcggtggagctggtgccgggcccggcgccggtcgccccgaccagcgag
gccgatgctgcgcctgccgacgaggcccccaaggccgaataa

DBGET integrated database retrieval system