KEGG   Aeromonas aquatica: BOQ57_02865Help
Entry
BOQ57_02865       CDS       T04629                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aaj  Aeromonas aquatica
Pathway
aaj00620  Pyruvate metabolism
aaj00680  Methane metabolism
aaj01100  Metabolic pathways
aaj01120  Microbial metabolism in diverse environments
aaj01200  Carbon metabolism
Module
aaj_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BOQ57_02865
  09102 Energy metabolism
   00680 Methane metabolism
    BOQ57_02865
Enzymes [BR:aaj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BOQ57_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: APJ13902
LinkDB All DBs
Position
complement(591145..593778)
Genome map
AA seq 877 aa AA seqDB search
MNEKYTALRANVGMLGQLLGKSIKDHQGQAFLDKIETIRQLAKSSRKGNETDRERLLDTL
RNLSDDELLPVARAFSQFLNLANVAEQFHTISRRCEEQVCTPDPLEQMFDKLKASNLSQE
AIIQAVRELDIDLVLTAHPTEVTRRTLIHKHVQLNDCLEALELSDLLPRERDKILNRIEQ
LVNQAWHTNEIREQRPTPVDEAKWGFAVVENSLWPAIPEFMRNLDERLQHHLGVRLPLDA
APVKFTSWMGGDRDGNPFVTAKVTAEVLELGRWMAVSLFYKDIKELTSELSMSDCTDAVR
ERVGDHPEPYRALVRELREQLRETQEFLTAKVQGQASESRDLVKTTAQLREPLELCYHSL
HACGMGNIADGMLLDVLRKLACFGIHLVKLDIRQDGERHGQVFSELTRYLGMGDYAEWSE
DDKQAFLLSELNSRRPLIPTDWEPSDETRETLDTCKVIAQHDPDAFGIYIISMAGAPSDV
LAVQLLLKEAGCKFRMPVAPLFETQEDLMAGTAVMERLLSVDWYRGYIQGRQYVMIGYSD
SAKDAGMMAAGWAQYAAMESLVALAEANNLRLTLFHGRGGTVGRGGAPAHQAILSQPPGS
LRGGLRVTEQGEMIRFKFGLPKVAIQSLNLYTSAVLEGNLLPPPKPKECWRAVMEQLASV
SCDHYRSIVRGHPDFVPYFRAATPEMELGKLPLGSRPSKRKPNGGVESLRAIPWIFAWTQ
NRLMLPAWLGAHKGLQQAIADGQKGVLEEMSRQWPFFRTRLEMLEMVFLKADVWLAEYYD
TRLVPKELWGLGKQLRQELADSIQVVLELRPQGDLLDDQPWIKESIKLRNPYTDPLNVLQ
VELLGRSRNHAETLHPELDQALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaagtacaccgcactacgcgccaacgtaggcatgctgggtcaactgctgggc
aagtccatcaaggatcatcagggacaggccttcctcgacaagatcgaaaccattcgccag
ctggccaaatcctcccgcaaaggcaatgagacagaccgggaacgtctgctcgataccctg
cgcaatctgagcgatgacgagctgctgccggtggcccgtgccttcagccagtttctcaac
ctggccaacgtggccgaacagttccacaccatctcccgtcgctgcgaagagcaggtctgt
accccggatccgctcgagcagatgttcgacaagctgaaagcttccaacctgtcgcaggaa
gccatcatccaggccgtgcgcgagctggacatcgatctggtgctgaccgctcaccccacc
gaggtgacccgtcgcaccctgatccacaagcacgtacagctcaacgactgcctcgaggcg
ctggaactctcagatctgctgccccgcgagcgggacaagatcctcaatcgcatcgaacag
ctggtcaaccaggcctggcacaccaacgagatccgcgaacagcgcccgaccccggtggac
gaggccaagtggggcttcgccgtggtggaaaacagcctgtggccggccatccccgaattc
atgcgcaatctggacgagcggctgcaacaccacctgggtgtgcggctgccgctggatgcc
gcgccggtcaagttcacctcctggatgggcggtgaccgcgacggcaaccccttcgtcacc
gccaaggtaactgccgaagtgctggagctgggccgctggatggcggtgagcctgttctac
aaggacatcaaggagctcacctccgagctctccatgtccgactgcaccgacgccgtgcgc
gagcgagtcggtgatcaccccgagccttaccgcgccctggtacgcgagttgcgcgaacag
ctgcgcgaaacccaggagttcctcaccgccaaggtgcagggccaggcgagcgagagccgg
gatctggtcaagaccaccgcccagctgcgcgagccgctggagctctgctaccactccctg
cacgcctgcggcatgggcaacatcgccgatggcatgctgctggacgtgctgcgcaagctg
gcctgcttcggcatccatctggtcaagctggacatccgtcaggatggcgagcgccacggc
caggtcttctccgagctgacccgctacctcggcatgggtgactacgccgagtggagcgag
gacgacaagcaagccttcttgctgagcgaactcaactcccgccgcccgctcatcccgacc
gactgggagccgagcgacgagacccgcgagaccctggatacctgcaaggtcatcgctcag
cacgaccccgacgcgttcggcatctacatcatctctatggctggcgcgccgtccgacgtg
ctggcggtgcagctgctgctgaaagaggccggctgcaagttccgcatgccggtcgccccg
ctgttcgaaacccaggaagacctgatggcgggtaccgccgtgatggagcgcctgctgtcg
gtggactggtatcgcggttacatccagggccgtcagtacgtgatgatcggctactccgac
tccgccaaggacgcgggcatgatggccgccggctgggcccagtacgccgccatggaatct
ctggtggcactggccgaggccaacaacctgcgcctgaccctgttccatggccgtggcggt
accgtcggccgtggtggcgcgcctgcccatcaggccatcctgtcgcaaccgccgggatcc
ctgcgcggtggcctgcgggtgaccgaacagggcgagatgatccgcttcaagttcggcctg
cccaaggtggccatccagagcctcaacctctacaccagcgccgtgctggaggggaacctg
ctgccaccgcccaagcccaaggagtgctggcgcgccgtgatggagcagctggcgtctgtc
tcctgcgatcactaccgcagcatcgtgcgcggtcatccggacttcgtgccctacttccgc
gccgccaccccggagatggagctcggcaagctgccgctcggttcacgcccctccaagcgc
aagcccaacggcggggtcgagagcctgcgcgccatcccctggatctttgcctggacccag
aaccggctgatgctgccggcctggctcggtgcccacaaggggctgcagcaagccatcgcc
gacggccagaagggcgtgctggaagagatgagccgccagtggcccttcttccgcacccgc
ctcgagatgctggagatggtgttcctcaaggctgacgtctggctggccgaatactacgac
acccggctggtgcccaaagagctgtggggcctcggcaaacagctgcgtcaggagcttgcc
gattccatccaggtggtgctggagctgcgcccgcagggcgacttgctcgacgaccagccc
tggatcaaggagtccatcaagctgcgcaacccctacacagacccgctcaacgtgctgcag
gtcgagctgctgggccgctcgcgcaaccatgccgagaccctgcatcccgagctggatcag
gcgctgatggtcaccatcgccggtattgcggccggtatgcgcaacaccggttga

DBGET integrated database retrieval system