KEGG   Aeromonas hydrophila MX16A: BOQ57_04925Help
Entry
BOQ57_04925       CDS       T04629                                 

Definition
(GenBank) UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase
  KO
K07806  UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC:2.6.1.87]
Organism
aaj  Aeromonas hydrophila MX16A
Pathway
aaj00520  Amino sugar and nucleotide sugar metabolism
aaj01100  Metabolic pathways
aaj01503  Cationic antimicrobial peptide (CAMP) resistance
aaj02020  Two-component system
Module
aaj_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BOQ57_04925
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BOQ57_04925
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BOQ57_04925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:aaj01005]
    BOQ57_04925
   01007 Amino acid related enzymes [BR:aaj01007]
    BOQ57_04925
Enzymes [BR:aaj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.87  UDP-4-amino-4-deoxy-L-arabinose aminotransferase
     BOQ57_04925
Lipopolysaccharide biosynthesis proteins [BR:aaj01005]
 Unusual sugar
  BOQ57_04925
Amino acid related enzymes [BR:aaj01007]
 Aminotransferase (transaminase)
  Others
   BOQ57_04925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP OKR_DC_1 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: APJ14289
LinkDB All DBs
Position
complement(1038591..1039727)
Genome map
AA seq 378 aa AA seqDB search
MQDFLPFSRPAIGDAEISAVCDVLKSGWITTGPKNHELEQQFCDTFGCQHAVALCSATAG
MHVTLLALGIGPGDEVITPSQTWVSTINIITLLGAEPVFVDVDPDTLMTSAELITPLITS
KTKAIIPVHYAGAPVDLDPILDLARQHGIPVIEDAAHAVGTRYRERWIGASGTAIFSFHA
IKNLTCAEGGMLVTDNKALADKVRMLKFHGLGVDAFDRMSLGRKPQAEVIIPGFKYNLAD
INAAIALVQLARLPELNAKRAELVARYQERLAGLPLAPLTVPGYPHLHAWHLFMVRVDPE
RCGLDRDQLMQALQERGIGTGLHFRAAHTQKYYRERYPTLSLPHTEWNSSRLCTLPLFPD
MTLADVDRVVAALIDILE
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattttctgccattttcgaggcccgccatcggtgatgccgagataagtgctgtc
tgtgacgtattgaaatcgggctggatcaccacgggcccgaagaatcatgaactggaacag
caattctgcgacacattcggctgccagcacgcggtcgcgctctgctccgccaccgccggc
atgcacgtcaccctgctggcgctgggcataggcccgggagatgaggtgatcaccccctcc
cagacctgggtctccaccatcaacatcatcaccctgctgggggccgagccggtcttcgtc
gacgtggacccggataccctgatgaccagcgccgagctgatcacgccgctcatcacgtcc
aagaccaaagccatcatcccggtccactacgccggtgccccggtcgatctggaccctatc
ctcgacctggcacgccagcacggcatccccgtcatcgaagatgcggcccacgcggtcggc
acccgctatcgggaacgctggatcggcgccagcggcaccgccatcttctccttccacgcc
atcaagaacctgacctgcgccgaagggggcatgctggtgaccgacaacaaggcgctggcg
gacaaggttcggatgctcaaattccacggcctgggggtggatgcctttgatcgcatgagc
ctgggccgcaagccgcaggcggaggtgatcatcccgggcttcaaatacaacctggccgac
atcaacgccgccatcgccctggtgcagctggcgcgcctgcccgaactcaacgccaagcgg
gccgaactggtggcccgctaccaggagcgactggccggtctgccgctggcgccgctcacc
gtgccgggctacccccacctgcacgcctggcacctgttcatggtgcgggtcgacccggaa
cgctgcgggctcgaccgggatcagctgatgcaggcactgcaggagcgcggcatcggcacc
ggtcttcactttcgggcggcccacacccagaaatactaccgcgaacgctacccgaccctc
agcctgcctcataccgagtggaactcgtcgcgcctgtgcaccctgccactcttcccggac
atgacgctggccgacgtcgaccgcgtggtcgcggcccttatcgacattttggagtaa

DBGET integrated database retrieval system