KEGG   Aeromonas hydrophila MX16A: BOQ57_08485Help
Entry
BOQ57_08485       CDS       T04629                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aaj  Aeromonas hydrophila MX16A
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BOQ57_08485
Enzymes [BR:aaj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BOQ57_08485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 AlaDh_PNT_C K_oxygenase FMO-like Glutaredoxin FMN_bind NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: APJ14962
LinkDB All DBs
Position
complement(1815836..1817416)
Genome map
AA seq 526 aa AA seqDB search
MLDTNLKQQLNTYLQYIVNPIEISVSGNDSDKSAELLALAGEIAEMSPKIAMTDGTAARK
PSMSVAPKGQAPRVHFAGIPMGHEFTSLVLALLQSGGHPSKADAAVQEQIRNLKGEFHFE
TYISLSCHNCPDVVQALNLMATLNPGITHTMIDGALFQDEVNERQIMAVPNVYLNGQPFS
QGRISLEEIVAKLDTGAAERKAEELSAKAPYDVLVVGGGPAGAAAAIYAARKGIRTAIVA
ERFGGQVMDTVGIENFISVPYTEGPKLAASLEQHVKQYGVEVITEQRAAAISKDGYVNVD
LASGATLKSRAVILATGARWRDLNVPGELEYRTKGVAYCPHCDGPFFKGKRVAVIGGGNS
GIEAAIDLAGIVEHVTVVEFADTLRADEVLQKKARSMGNIDIIMSARTTEVIGDGSKVVG
MDYEDRTTGEIKHLAVAGIFVQIGLVPNTEFLKGSDVALTRFGEIEIDTKGATSLPGVYA
AGDATTVPFKQIIISMGAGATAALGAFDYLIRNPAPEATKADAVTA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttggataccaacctcaaacaacagctgaacacctatctgcagtacatcgtcaatccc
atcgagatcagcgtgtccggcaacgacagtgacaaatccgccgaactgctggccttggct
ggcgagatcgccgagatgtcccccaagattgccatgaccgatggcactgccgcccgcaag
ccttccatgagcgtcgcaccgaagggccaggccccgcgcgttcattttgccggcatcccc
atgggtcatgaatttacctccctggtgcttgccctgctgcaaagcggcggtcacccctcc
aaggccgatgcggccgtgcaggagcagatccgcaacctcaagggcgagttccacttcgag
acttacatttcgctctcctgccataactgcccggacgtggtgcaggccctcaacctgatg
gccaccctgaaccccggcatcacccacaccatgatcgacggtgccctgttccaggacgag
gtcaacgagcgtcagatcatggcggtaccgaacgtctacctgaacggtcagccgttcagc
cagggccgcatttcgctcgaagagatcgtcgccaagctcgacactggcgccgccgaacgc
aaagctgaagagctgagcgcaaaagccccttacgacgtactggtcgtcggtggtggcccg
gctggcgcagccgccgccatctatgccgctcgcaaaggcattcgcaccgccatcgtcgcc
gagcgtttcggtggccaggtgatggacactgtcggcatcgagaacttcatctccgtgccc
tacaccgaaggccccaagctggccgcgagcctggagcagcacgtcaagcagtacggcgtg
gaagtgatcaccgaacagcgcgccgccgccatcagcaaggatggctacgtcaacgtggat
ctggcctctggcgctaccttgaagagccgcgccgtgatcctggcgaccggtgcacgctgg
cgcgacctgaacgtgccgggcgagctcgagtaccgcaccaagggcgtggcctactgcccg
cactgtgacggccccttcttcaagggcaagcgggttgcggtgatcgggggcggcaactcc
ggcatcgaggcggccatcgacttggcaggcatcgtcgagcacgtcaccgtagtggagttt
gccgacaccctgcgtgccgacgaggtattgcagaagaaggcccgctccatgggcaacatc
gacatcatcatgagcgcccggaccaccgaagtgatcggtgatggcagcaaagtggtgggc
atggattacgaagatcgcaccaccggtgagatcaagcatctggcagtggccggcatcttc
gtccagatcggtctggtgccgaacaccgagttcctcaaggggagcgacgtggccctgacc
cgctttggcgagatcgagatcgacaccaagggcgccacctccctgcccggcgtctacgcc
gcaggggacgccaccacggtgccgttcaaacagatcatcatctccatgggcgccggggcg
actgccgcactgggagcgtttgattacctcattcgcaatccggcgccggaagcgaccaaa
gctgacgccgtcaccgcctga

DBGET integrated database retrieval system