KEGG   Aeromonas hydrophila MX16A: BOQ57_09055
Entry
BOQ57_09055       CDS       T04629                                 

Definition
(GenBank) type VI secretion system ImpA domain-containing protein
  KO
K11910  type VI secretion system protein VasJ
Organism
aaj  Aeromonas hydrophila MX16A
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aaj02044]
    BOQ57_09055
Secretion system [BR:aaj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BOQ57_09055
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: APJ15066
LinkDB
Structure
PDB: 
6G7B 6G7C

Position
1929127..1930572
AA seq 481 aa
MSYQHPWCARLLTSLPDEQIRGAVLTDEPRWDYVETELVKLGSLAHSQVDLNAVAEACLG
LLESRTKDMRVLAQLLRCLQHPAKATPLGAAISLLEAWIQAYWLLAWPGNASQKQRLMVQ
IVKRFDGALPRICESASAAELAQLLAQAEQLERVWLAQCPDKGELLDPLVMGLKRAQRQQ
LAQAEANAAGQPQSSGAAAAGSPVSVASTASGAGAMVLSGGGGSAGVDVDSSNDRAWRQT
QLKVAELLIERQPDAAVGYRLRRHAVWAGITAVPMSGAGNKTPLAPMSADMVDEYRAAMN
APDLGLWQRIEQSLTLAPYWFEGHRLSAEVAQKLGFGAVAQAIAEELGTFLQRLPALREL
AFSDGSPFLSPECSRWLQPAKGGSAGSGEAGLAEEVAQRHGEQGVAAALALLDERIAQLK
EPRDRFHALLVQAELLAQEGMEALARQHYQHLWQEASRLGLSHWEPGLVNRLESLAAPLS
K
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgagctatcaacacccctggtgtgcacgcctgctcaccagcctgccggatgaacagatc
agaggcgccgtgctgaccgacgagccgcgctgggactacgtggagaccgagctggtcaag
ctgggatccctcgctcacagccaggtggatctcaatgcggtggccgaggcctgcctcggc
ttgctggagagccgcaccaaggacatgcgggtgctggcccagctgctgcgctgtttgcag
cacccggccaaggcgaccccgctgggggcggcgatcagtctgctggaggcctggatccag
gcttactggctgctggcctggcccggcaatgccagccagaaacagcgactgatggtgcag
atcgtcaagcgcttcgacggggcgctgccgcgcatttgcgagagcgcctcggcagccgag
ctggcccagttgctggcccaggccgagcagctggagcgagtctggctggcgcagtgtccc
gacaagggggagctgctcgacccactggtgatggggctgaaacgggcccagcgccagcag
ctggcacaggccgaggccaatgccgccgggcagccccagagcagcggcgctgcggcagcg
ggctccccggtctcggtggcgtctactgccagcggtgccggcgccatggtgctcagcggc
ggtggcggcagtgccggcgtcgacgtcgacagttccaacgatcgcgcctggcgccagacc
cagctgaaggtggcggagctcctgatcgagcgtcagcccgatgccgcggttggctatcga
ctgcgccgtcatgccgtctgggccgggatcacggcggtccccatgagcggggcgggcaat
aaaaccccgctggcgcccatgtcggcggacatggtggacgagtaccgcgccgccatgaac
gcccctgatctggggctctggcagcgcatcgagcagagcctgaccctggcgccttactgg
ttcgaggggcataggctctcggccgaggtggcccagaaactcggcttcggggcggtggcc
caggcgatcgccgaggagctcgggacttttctgcagcgcctgccggccctgcgggagctc
gcttttagcgacggttcgccgtttctctcccccgagtgcagccgctggctgcaaccggcc
aagggcggcagtgcgggcagtggcgaagctgggctggccgaggaggtcgcccagcgccac
ggcgagcagggggtcgcggcggcgctcgccctgctcgatgagcggattgcgcagttgaaa
gagccaagagatcgcttccacgccttgctggtgcaggcggagctgttggcgcaggaaggc
atggaggcgcttgcgcgccagcactatcaacacttgtggcaagaggccagtcgccttggg
ttgtcgcactgggagcccgggctggtcaaccgcctggagagcctggcggcgccgttgtcg
aaatga

DBGET integrated database retrieval system