KEGG   Aeromonas hydrophila MX16A: BOQ57_10230Help
Entry
BOQ57_10230       CDS       T04629                                 

Definition
(GenBank) GNAT family N-acetyltransferase
  KO
K03827  putative acetyltransferase [EC:2.3.1.-]
Organism
aaj  Aeromonas hydrophila MX16A
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BOQ57_10230
Enzymes [BR:aaj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     BOQ57_10230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_10 Acetyltransf_7 Acetyltransf_1 FR47 Acetyltransf_6 Acetyltransf_CG
Motif
Other DBs
NCBI-ProteinID: APJ15282
LinkDB All DBs
Position
2194638..2195105
Genome map
AA seq 155 aa AA seqDB search
MRLEQAVRADYQALIALWEASVRATHHFLPDEEIATLRELILAHYFDAVTLTCARSEQGI
AGFCGVHEGNIEMLFIDPALRGGGVGRLLVADAIDRLGASRVDVNEQNEQALGFYRRLGF
EVVGRSALDGQGRPYPLLHMSIATAGTDRPAVPAQ
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagactggagcaggccgtacgcgcggattatcaggccctgatcgcgctgtgggaggcg
tcggtgcgcgccacccaccattttttgccggatgaggagatcgccaccctgcgcgagctc
atcctggcacattacttcgacgctgtgaccctcacctgcgcccgcagtgagcaggggatc
gctggcttttgcggggtgcacgagggcaacatcgagatgctgttcatcgaccccgcactg
cgcgggggcggggtgggtcgcctgctggtggccgatgccatcgaccggctgggggcgagc
cgggtggacgtcaacgagcagaatgagcaggcgctcggcttctatcgccgcctgggcttc
gaggtggtggggcgctcggcgctggacgggcagggcagaccctatccattgctgcacatg
tccattgcgacggctggcactgacaggccggcggtgccggcccagtaa

DBGET integrated database retrieval system