KEGG   Aeromonas hydrophila MX16A: BOQ57_10290Help
Entry
BOQ57_10290       CDS       T04629                                 

Definition
(GenBank) hypothetical protein
  KO
K07308  anaerobic dimethyl sulfoxide reductase subunit C
Organism
aaj  Aeromonas hydrophila MX16A
Pathway
aaj00920  Sulfur metabolism
aaj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BOQ57_10290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aaj02000]
    BOQ57_10290
Transporters [BR:aaj02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   BOQ57_10290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: APJ15294
LinkDB All DBs
Position
2206734..2207453
Genome map
AA seq 239 aa AA seqDB search
MFVQLPFWLFPLTGLMALGALIALGLVFWRGDLCPGQRSRITTQLFSVWVITGLSLMLAV
EAKAADWLIWSGAAALILGVVLSLAQSRLEGKRAIPATLFWLPAMPLLVYGIGLLQIQGW
LGGLLQMVLLGAAFAHLMLLRARHRLQAFNTLLPLAGLVAAILSLLWLAVLVGWQGSSAS
LDALIPGVLTQAALLIAALLLWFSPLYRQQETAPVVVSTALCGLIIAQLAATSVLHQLA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtccaactccctttttggctctttcccctgaccggcctgatggcgctgggggcc
ctcatcgccctgggcctggtgttctggcgcggtgatctctgcccgggccagcgctcgcgg
atcaccacccagctcttctcggtctgggtgatcaccggcctctccctgatgctggcggtg
gaggccaaggcggccgactggctgatctggagtggtgctgccgccctgatcctgggggtg
gtgctgtcgctggcccagtcccggctggagggcaagcgcgccattcccgccacgctgttc
tggctgccggccatgccgctgctggtctatggcatcggcttgctgcagatccagggctgg
ctcggcggcctgctgcagatggtgctgctgggggcggcctttgcccacctgatgctgctg
cgggcccgtcaccgcctgcaggcgttcaataccctgctgccgctggccgggctggtggcc
gccatcctgagcctgctctggctggcggtgctggtgggctggcaggggagcagcgccagc
ctcgatgcgctgatccctggcgtgctgacccaggctgccctgctgatcgcggccttgctg
ctctggttcagcccgctctatcgccagcaggagacggcgccggtggtggtctccaccgcc
ctgtgcggcctcatcatcgcccagcttgcggcgaccagcgtgctgcaccagctggcctga

DBGET integrated database retrieval system