KEGG   Aeromonas hydrophila MX16A: BOQ57_10840
Entry
BOQ57_10840       CDS       T04629                                 

Definition
(GenBank) 23S rRNA (guanine(2445)-N(2))/(guanine(2069)-N(7))-methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
aaj  Aeromonas hydrophila MX16A
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aaj03009]
    BOQ57_10840
Enzymes [BR:aaj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     BOQ57_10840
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     BOQ57_10840
Ribosome biogenesis [BR:aaj03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BOQ57_10840
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_31 MTS Methyltransf_11 Methyltransf_15 Pep_deformylase
Other DBs
NCBI-ProteinID: APJ15392
LinkDB
Position
2326012..2328183
AA seq 723 aa
MRHYFYGFPVSVMKEFFATCPKGLENLLAVELTNLGAEQVRETVAGVHFKGELAIGYKAC
LWSRFASRIVLVLSEFQMNDDLDLYLGAHTIPWEEHFSGTSTIAVDFTGTNPAIRNTQYG
ALKIKDAIVDRFTKRGHVRPDVDKKSPDIRIMAHLGKGKANITLDLSGPALHQRFYRQGT
GEAPLKENLAAAMIARSGWAGEPMMDPMCGSGTLLVEAAFIAADMAPALRRERFGFDRWL
QHDSELWQSLLMEAQVRAKRGMQRCEVKLFGCDADSRVLLKARDNAKAAGVAHLIIFKQA
DVTALENLLPMPAVEGEARQVGMLISNPPYGERLGEFPALLEVHQALGDALRRSFQGWKV
SILSASPELLSCLRLRADKQYRLFNGALECQLRNYQIAQDSVASQKEVAQDFANRLRKNL
KTLEKWAQKENLDCYRLYDADLPEYNAAIDRYQDYLVVQEYAAPKDIPAQKTRQRLLDMV
QAAIKVTGMDGEKVILKVRERQEGKQQYQKLSEEQHRMEVQEYGARLWVNLYDYLDTGLF
LDHRQTRRMLGQMAKGKRFLNLFAYTGSATVHAGLGGASETTTVDMSRTYLNWAQDNMRL
NSLVGREHKFVQADCLKWLSEADEQYDLIFIDPPTFSNSKRMDESFDVQRDHLLLMQHLK
RLLAAGGTLVFSNNKRHFKMDLAGLEAIGLKAQNITGKTRPKDFERNQHIHNCWIITHAE
TEA
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgcggcactatttttatgggttccccgtgagcgtgatgaaagaattttttgcaacctgc
cccaaagggctggaaaacctgttggccgtcgagctgaccaacctgggcgcagagcaggtc
cgtgagaccgtggctggcgtgcacttcaaaggcgaactggcgattggctacaaggcctgt
ctgtggagccgtttcgcctcccgcatcgtgctggtgctgtccgaattccagatgaatgac
gacctggatctctatctgggtgctcacaccattccctgggaagagcacttctccggtacc
tccaccattgccgtggattttaccggtaccaatccggccattcgcaatacccagtacggt
gctctgaagatcaaggatgccatcgtcgatcgcttcaccaagcgcggtcatgtgcgtcct
gacgtggacaagaagtcgccggacattcgcatcatggcgcacctgggcaagggcaaggcc
aatatcacgctggacttgtcaggccccgcgttgcaccagcgcttctatcgtcagggcacc
ggcgaggcgccactcaaagagaacctggccgccgccatgattgcccgtagtggctgggcc
ggcgagcccatgatggaccccatgtgtggctccggtacgctgctggtggaagccgccttt
atcgccgccgacatggcaccggccctgcgccgtgagcgtttcgggttcgatcgctggctg
caacacgatagcgagctgtggcagagcctgctgatggaggctcaggttcgggccaagcgc
ggcatgcagcgttgtgaagtgaagctgtttggttgtgatgcagacagccgcgtgctgctc
aaagcccgcgacaacgccaaagccgccggcgtggcccatctcatcatcttcaaacaggcc
gatgtcaccgcgctggaaaacctgctgccgatgccggcagtggaaggggaggcccgtcag
gtcggtatgctgatctcaaaccccccctatggcgagcgtcttggcgagttcccggcactg
ctggaagtgcatcaggccctcggcgatgccctgcgtcgcagcttccagggctggaaagtc
tccattctttccgcatcccccgagcttttgagctgtctgcgtctgcgcgccgacaagcaa
taccgcctgttcaacggcgccctcgaatgtcagctgcgcaactaccagattgcacaggac
tccgttgcttcccagaaagaggtggcgcaggactttgccaaccgtctgcgcaagaatcta
aagaccctggagaagtgggcacagaaagagaacctcgactgctatcgcctctatgacgcc
gatctgccggaatacaacgccgccatcgaccgttatcaggactatctggtggtgcaggag
tacgcggcgcccaaggacattcccgcccagaagacccgtcaacgcctgctcgacatggtg
caggccgccatcaaggtgaccggcatggacggcgagaaggtgatcctgaaagtgcgcgag
cgtcaggaaggcaaacagcagtaccagaagctctccgaagagcagcacaggatggaagtg
caggagtatggcgcccgtctgtgggtcaatctctatgactatctcgacaccgggctgttc
ctcgaccaccgtcagacccgccgcatgctgggtcagatggccaagggcaagcgcttcctg
aacctctttgcctacaccggcagtgccaccgtgcacgcggggctcggcggtgccagcgaa
accaccacggtggacatgtcgcgcacctacctcaactgggcacaagacaacatgcgcctc
aactcgctggtgggccgagagcacaagttcgtgcaggccgactgcctgaagtggctctcc
gaggcggacgagcagtacgacctcatcttcatcgatccgcccaccttctccaactccaag
cggatggatgagagcttcgacgtgcagcgcgatcacctgctgctgatgcagcacctgaag
cggctgctggctgcgggtggcaccctggtgttctccaacaacaagcgccacttcaagatg
gatctggctggtctcgaggccattggtctcaaggcccagaacatcaccggcaagacccga
cccaaggatttcgagcgcaaccagcatatccacaactgctggatcatcacccatgcggag
actgaggcctga

DBGET integrated database retrieval system