KEGG   Aeromonas hydrophila MX16A: BOQ57_13355Help
Entry
BOQ57_13355       CDS       T04629                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
aaj  Aeromonas hydrophila MX16A
Pathway
aaj00473  D-Alanine metabolism
aaj01100  Metabolic pathways
aaj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BOQ57_13355
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BOQ57_13355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aaj01011]
    BOQ57_13355
Enzymes [BR:aaj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BOQ57_13355
Peptidoglycan biosynthesis and degradation proteins [BR:aaj01011]
 Precursor biosynthesis
  Racemase
   BOQ57_13355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: APJ15845
LinkDB All DBs
Structure
PDB: 

Position
2883791..2885017
Genome map
AA seq 408 aa AA seqDB search
MHKKTLLATLILGLLAGQAVAAPYLPLASDHRNGEVQTASNAWLEVDLGAFEHNIQTLKD
RLGDKGPKICAIMKADAYGHGIDLLVPSVVKAGIPCIGIASNEEARVAREKGFTGRLMRV
RAATPAEVEQALPYKMEELIGSLVSAQGIADIAQRHHTNIPVHIALNSAGMSRNGIDLRL
ADSKEDALAMLKLKGITPVGIMTHFPVEEKEDVKMGLAQFKLDSQWLLEAGKLDRSKITI
HAANSFATLEVPDAYFDMVRPGGLLYGDSIPSYTEYKRVMAFKTQVASVNHYPAGNTVGY
DRTFTLKRDSWLANLPLGYSDGYRRALSNKAYVLIQGQKVPVVGKTSMNTIMVDVTDLKG
VKPGDEVVLFGRQGEAEVKQADLEEYNGALLADMYTIWGYTNPKKIKR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagaagacactgctggccacgctgatcctgggcctgctggccggtcaggccgtc
gcggccccttacctgccgctggccagcgatcatcgcaacggcgaagtgcagaccgccagc
aatgcctggctggaagtcgatctcggcgccttcgagcacaacatccagaccctcaaggat
cgcctcggtgacaaggggccgaagatctgcgccatcatgaaagcagacgcctacggccac
ggcatcgacctgctggtgccctcggtggtcaaggccggcatcccctgcatcggcatcgcc
agcaacgaagaggcccgcgtggcccgtgagaagggcttcaccggccgcctgatgcgggta
cgtgccgccaccccggccgaagtggaacaggccctgccctacaagatggaagagctcatc
ggcagcctggtgagtgctcagggcatcgccgacatcgcccagcgccaccacaccaatatc
ccggtgcacatcgcgctcaactccgccggcatgagccgcaacggcatcgatctgcgcctg
gctgactccaaggaagacgcgctggccatgctcaagctcaaggggatcaccccggtcggc
atcatgacccacttcccggtggaggagaaagaggacgtcaagatggggctggcccagttc
aaactggactcccagtggctgctggaagcgggcaagctggatcgcagcaagatcaccatc
cacgccgccaactccttcgccaccctggaagtgccggacgcctacttcgacatggtgcgc
ccgggcggcctgctgtacggtgactccatcccctcctacaccgagtacaagcgggtgatg
gcgttcaagacccaggttgcctccgtcaaccactacccggccggcaacaccgtcggttat
gaccgcaccttcaccctcaagcgcgactcctggctcgccaacctgccgctgggctactcc
gacggctatcgccgggcgttgagcaacaaggcttatgtgctgatccagggccagaaggtg
ccggtggtgggtaagacctccatgaacaccatcatggtggacgtgaccgatctgaaaggg
gtcaaacccggtgacgaggtggtgctgttcggccgccagggtgaagccgaggtgaaacag
gcagatctggaagagtacaacggcgccctgctggcggacatgtacaccatctggggctac
accaaccccaagaagatcaagcgctga

DBGET integrated database retrieval system