KEGG   Aeromonas hydrophila MX16A: BOQ57_13920Help
Entry
BOQ57_13920       CDS       T04629                                 

Definition
(GenBank) amino acid ABC transporter substrate-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
aaj  Aeromonas hydrophila MX16A
Pathway
aaj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BOQ57_13920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aaj02000]
    BOQ57_13920
   02035 Bacterial motility proteins [BR:aaj02035]
    BOQ57_13920
Transporters [BR:aaj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    BOQ57_13920
Bacterial motility proteins [BR:aaj02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    BOQ57_13920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1 ADH_zinc_N PG_isomerase_N
Motif
Other DBs
NCBI-ProteinID: APJ15946
LinkDB All DBs
Position
complement(3024242..3025015)
Genome map
AA seq 257 aa AA seqDB search
MKKRHSLFLMAALPLALMTSVQAQSSLAEIQRAGVIKIGTEGAYPPFTYHDKSGKLVGFD
VEIGELIASGLGVKPQFVEGKWDGLIAGVDAKRYDLVLNEVAITPERLKKYDFSDPYITS
KAVIVVHSDNHSIKSFADLKGKKSSQSLTSNFAQLAKASGAEVVATEGFNQSLELVLTGR
VDATLNDSLSFLDFKKQKPDAKLKVAATEAKGDQSGALLAKGQPELLAAINQALRNAKQD
GAYQKISQKYFGTDVSQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacggcactccctgtttttgatggcggcacttccgctggcactgatgacatcg
gtacaggcacagtcaagcctggccgagatccagcgggccggggtgatcaagatcggtacc
gaaggggcctatcctcccttcacctatcacgacaagagcggcaagctggtgggctttgac
gtggagatcggcgagctgattgcaagcggtctcggcgtgaagccgcagttcgtcgagggc
aagtgggacgggctcatcgccggggtggacgccaagcgctacgacctggtgctcaacgaa
gtggccatcacccctgagcggctgaaaaagtatgatttttcagacccctacatcacctcc
aaagcggtgatcgtggtgcacagcgacaaccacagcatcaagagttttgccgatctgaag
ggcaagaaatcctcccagtcgctgaccagcaacttcgcccagctggcgaaagcatcgggc
gccgaggtggtggccaccgagggattcaaccagtccctcgaactggtgctgaccgggcgg
gtggatgccaccctcaacgacagcctctcgttcctcgacttcaagaaacagaagccggac
gccaaattgaaggtggcggccaccgaggccaagggggatcaatcgggggccctgctcgcc
aagggacaacccgagttgctggccgccatcaatcaggcgctgcgcaatgccaagcaggat
ggcgcatatcagaaaatatcgcagaaatatttcggcaccgacgtttcgcaataa

DBGET integrated database retrieval system