KEGG   Aeromonas hydrophila MX16A: BOQ57_19410Help
Entry
BOQ57_19410       CDS       T04629                                 

Definition
(GenBank) alanine--tRNA ligase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
aaj  Aeromonas hydrophila MX16A
Pathway
aaj00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BOQ57_19410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aaj01007]
    BOQ57_19410
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aaj03016]
    BOQ57_19410
Enzymes [BR:aaj01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     BOQ57_19410
Amino acid related enzymes [BR:aaj01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   BOQ57_19410
Transfer RNA biogenesis [BR:aaj03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    BOQ57_19410
 Prokaryotic type
    BOQ57_19410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD
Motif
Other DBs
NCBI-ProteinID: APJ16906
LinkDB All DBs
Position
complement(4176085..4178709)
Genome map
AA seq 874 aa AA seqDB search
MYMSTSEIRAAFLEYFRSQGHQVVSSSSLVPHNDPTLLFTNAGMNQFKDVFLGADKRAYN
RATTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQDAIKFAWGFLTEVLQ
LPKERLLVTVYATDDEAFDIWEKEVGVPADRIVRIGDNKGAPYASDNFWAMGDTGPCGPC
TEIFYDHGDHIWGGRPGSPEEDGDRFIEIWNVVFMQFNRQADGTMEPLPRPSVDTGMGLE
RISAIMQGVHSNYEIDIFQALIKKAAEIVGTTDLSNQSLRVIADHIRSCAFLVADGVMPS
NEGRGYVLRRIIRRAVRHGRKLGATEVFFYKLAAELAAQMKDVAAELIAQLPLVERVLRI
EEEQFVRTLDRGLLLLEDVLANLGDAKVIPGEVVFKLYDTYGFPADLTADVVREREIGID
EEGFKAEMEKQRARAKEASSFGVNYNEMLKLDFETPFTGYKTLTERTRVVGIYKGVDEVS
GLIAGDEAVIVLEQTPFYAESGGQIGDSGTLKVDDGIFAVTDTVKAGKAIIHKGYMELGT
LEKGAEVEAVVDGERRQAIALNHSVTHLLHAALRQALGEHVTQKGSLVGAERMRFDFSHF
EGMTMATIRRVEELVNNQIRANHEITTQLMDLEAAKSAGAMALFGEKYEDDVRVVRMGDY
STELCGGTHAKRTGDIGFFKIIAESGIAAGVRRIEAVTGKAAIDFMHQVGEQIEEAAALV
KGDQFCIADKVRQVLDKAKMMERELEQLKAKLAAQAGNDLLGQVIEIKGQKVLVAALEGA
DPKSLRGMLDELKNQMKSGVVLLATSGEGKVNLIAGVTNDLTGKVKAGELVNLVAQQVGG
KGGGRPDMAQAGGTQPEAVPAALQSVHSWLEERL
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
atgtatatgtccacgtcagagattcgcgccgcgtttctcgagtatttccgttcccagggg
caccaggttgtctcctccagctcgctggtaccgcataacgacccgaccctgttgtttacc
aacgcgggtatgaaccagttcaaggacgtgttccttggcgcagacaagcgtgcctacaat
cgcgcgacgacctcccagcgttgcgtgcgtgccggtggtaagcacaacgatctggaaaac
gtcggctataccgctcgtcaccacaccttcttcgaaatgctgggcaacttcagcttcggc
gactacttcaagcaggatgccatcaagtttgcatggggcttcctgaccgaggtgctgcag
ctgccgaaagagcgcttgctggtgaccgtctacgcgactgacgatgaagccttcgacatc
tgggaaaaagaggtcggtgtaccggccgatcgcatcgtgcgcatcggtgacaacaagggc
gctccgtacgcctccgacaacttctgggcgatgggcgataccggtccgtgcggtccctgc
accgagatcttctacgatcacggcgatcatatctggggtggtcgtcccggctcaccggaa
gaggatggcgaccgtttcatcgagatctggaacgtggtgttcatgcagttcaaccgtcag
gctgacggcaccatggagccgctgccccgtccgtccgtggataccggcatgggtctggag
cgtatctccgccatcatgcagggtgtgcactccaactacgaaatcgacatcttccaggcc
ctgatcaagaaagcggccgagatcgtcggcaccaccgatctgagcaaccagtccctgcgc
gtcatcgcggatcacatccgctcctgcgccttcctggtggcagatggcgtgatgccgtcc
aacgaaggtcgtggctacgtgctgcgtcgcatcatccgccgcgccgtgcgtcacggtcgc
aagctgggtgccaccgaggtgttcttctacaaactggcagccgagctggcggcacagatg
aaggatgtcgccgccgagctgatcgcccagctgccgctggtcgagcgcgtgctgcgcatc
gaagaggagcagttcgtccgtactctggacagaggcttgctgctgctggaagacgtgctg
gccaacctgggcgatgccaaggtcattccgggcgaggtggtgttcaagctgtatgacact
tacggcttcccggccgacctgactgccgacgtggtgcgcgagcgcgagatcggcatcgac
gaagagggcttcaaggccgagatggagaagcagcgtgctcgcgccaaagaggcttccagc
ttcggcgtgaactacaacgagatgctcaagctcgacttcgagacccccttcaccggttac
aagaccctgaccgagcgcacccgtgtggtcggcatctacaagggcgtggacgaggtgagc
ggtctcatcgccggtgacgaagcggtcatcgtgctggagcagacccccttctacgccgag
tccggcggccagatcggcgacagcggcaccctgaaagtggacgacggcatctttgccgtg
accgataccgtcaaagcgggcaaggcgattatccacaagggctacatggagctgggcacc
ctggagaaaggggccgaggtcgaagccgtggtcgatggcgagcgccgccaggccatcgct
ctgaaccactccgtgactcacctgctgcacgcagccctgcgtcaggcgctgggtgagcac
gtgacccagaaaggctctctggtgggcgccgagcgcatgcgctttgacttctcccacttc
gaggggatgaccatggcgaccattcgccgggtcgaggagctggtcaacaaccagatccgc
gccaaccacgaaatcaccacccagctgatggatctggaagccgccaagtcggccggcgcc
atggcgctgtttggcgagaaatacgaagacgacgtgcgcgtggtgcgcatgggcgactac
tccaccgagctgtgcggcggtactcacgccaagcgcaccggtgatattggcttcttcaag
atcatcgccgagagcggcatcgccgccggtgtgcgccgtatcgaagcggtgaccggcaag
gccgccatcgacttcatgcatcaggtcggggagcagatcgaagaggctgccgcactggtg
aaaggtgaccagttctgcatcgccgacaaggtccgtcaggttctggacaaggccaagatg
atggaacgcgagctggagcagctcaaggccaagctggccgctcaggccggtaacgacctg
ctgggtcaggtcatcgagatcaagggtcagaaggtgctggttgcagcgctggaaggggcc
gatccgaaatccctgcgcggcatgctggacgaactgaagaaccagatgaagtccggtgtc
gtgctgctggccaccagtggcgagggcaaggtcaacctgatcgcgggcgtcaccaacgac
ctgaccggcaaggtcaaggccggtgagctggtcaatctggtcgcccagcaggtgggtggc
aagggcggcggtcgtcccgacatggcccaggcgggtggtacccagcccgaggcagtgccg
gcagccctgcaatccgtacactcctggctggaagagcgcctgtaa

DBGET integrated database retrieval system