KEGG   Aeromonas hydrophila MX16A: BOQ57_20300Help
Entry
BOQ57_20300       CDS       T04629                                 

Definition
(GenBank) peptidoglycan glycosyltransferase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
aaj  Aeromonas hydrophila MX16A
Pathway
aaj00550  Peptidoglycan biosynthesis
aaj01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:aaj00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BOQ57_20300
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BOQ57_20300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aaj01011]
    BOQ57_20300
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aaj03036]
    BOQ57_20300
Enzymes [BR:aaj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BOQ57_20300
Peptidoglycan biosynthesis and degradation proteins [BR:aaj01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BOQ57_20300
Chromosome and associated proteins [BR:aaj03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BOQ57_20300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: APJ17067
UniProt: A0A454GC67
LinkDB All DBs
Position
complement(4356092..4357846)
Genome map
AA seq 584 aa AA seqDB search
MKRKASAKAQPKVKAPSLYPWRFRTLVFFIGIAFAGLILRLAWIQVIDPDRLRQEGDMRS
LRTTSTQAVRGMITDRNGEQLAVSVPVEAVWADPKTVHESGAIHNERAWLALSAVLKLDI
NTLKHRISNPSKRFVYLQRQVTPAVAEYIKGLKLGGIYLRPEARRFYPTGEISAHLVGVT
NIDGSGIEGIERSYNEWLTATPGEMRVRKDRQGRVIERLGLVKEGKNANDLQLSIDQRVQ
ALAYRALKRATDENKATSGSMVMLDVKTGEVLAMVNTPSYNPNNRGQYQSFRVRNRVVTD
TYEPGSTVKPLILLSALQAGVTSWKDTIPGGPLFIGAKQIRDVSIHKATNLYDILRYSSN
IGMSRIALRMPAQEMINTLSMVGFGMDTGSGLMGESSGMLPQRRRWSDIERATLSFGYGL
RVTPLQLASAYATLANKGKRVPLSIVKVTEPPKGEQVIDHNNATAMLQALEYVVSNAIPK
AQIPGYRVGGKSGTAKVAVAGGYGKDYMAWFAGFAPASNPRFVMVVVINEPKGDAYYGGA
VATPPFAEAMGGVLQLFNIRPDAVPPAVPTKLARTEASNVVPRT
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaaggcttccgccaaggcccaacccaaggtcaaagctccgtcactctatccg
tggcgctttcgcacgctggtgttcttcatcggcattgcgtttgccggcttgatcctgcga
ctggcttggatccaggtgatcgacccggatcggctgcgccaggaaggggacatgcgttcg
ctgcgtaccacttccactcaggcggtgcgcggcatgatcaccgatcgcaacggcgaacag
ctggcggtttcggtgcctgttgaggctgtctgggccgatcccaagacggtgcatgaatcc
ggcgccatccataacgagcgggcctggctggccttgtccgccgtgctcaagctcgacatc
aacactctcaagcaccgtatctccaacccgagcaagcgcttcgtctacctgcagcgccag
gtgacgccggcggtggcggaatacatcaagggcctcaagctgggtggcatctatctgcgc
cccgaagcgcgccgtttctacccgaccggcgagatcagcgcccacctggtgggggtaacc
aatatcgacggcagcggcatcgaggggatcgagcgcagctacaacgagtggctgacagcg
actcccggcgagatgcgggtgcgcaaggacagacagggccgggtcatcgagcggcttggt
ctggtgaaagagggcaagaacgccaacgatctgcagctgagcatcgatcaacgggtgcag
gcgctggcctaccgggcgctcaagcgcgccaccgacgagaacaaggcgacctccggctcc
atggtgatgctggacgtcaagaccggcgaagtgctcgccatggtcaacaccccctcctac
aaccccaacaaccgcggccagtaccagagtttccgggtgcgtaaccgggtggtgaccgat
acctatgaaccgggctccaccgtcaagccgctgatcctgctcagcgccctgcaggccggc
gtcaccagctggaaggacaccattccgggtggcccgctgtttatcggggccaagcagatc
cgcgacgtgagtatccacaaggcgaccaacctgtacgatatcctgcgctactcctccaac
atcggcatgtcgcgcatcgcgctgcggatgccggcgcaggagatgatcaacaccctcagc
atggtgggcttcgggatggacaccggcagcggcctgatgggtgagagcagcggcatgctg
ccccagcgccggcgctggtccgatatcgaacgggccaccctgtcgttcggctatggcctg
cgggtcaccccgctgcagctggcctccgcctatgccaccttggccaacaagggcaagcgg
gtgccgctctccatcgtcaaggtgaccgagcctcccaagggggaacaggtcatcgatcac
aacaacgccaccgccatgctgcaggcgctggaatatgtggtcagcaatgccattcccaaa
gcacagatccccggttaccgcgtcggcggcaagagtggtaccgccaaggtcgcggtcgcg
ggtggctacggcaaggattacatggcctggttcgccggcttcgccccggccagcaatccc
cgtttcgtcatggtagtggtgatcaacgagcccaagggcgacgcctactatggtggcgcc
gtggcgacgccgccgtttgccgaggccatgggcggggtgctgcagctcttcaatattcgt
cctgacgcggtgccgcctgcggtgcctaccaaacttgcccgtacggaggcttccaatgtt
gtcccgcgcacttga

DBGET integrated database retrieval system