KEGG   Aminobacter aminovorans: AA2016_0970Help
Entry
AA2016_0970       CDS       T04343                                 

Definition
(GenBank) MFS transporter
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
aak  Aminobacter aminovorans
Pathway
aak00020  Citrate cycle (TCA cycle)
aak00310  Lysine degradation
aak00380  Tryptophan metabolism
aak01100  Metabolic pathways
aak01110  Biosynthesis of secondary metabolites
aak01120  Microbial metabolism in diverse environments
aak01130  Biosynthesis of antibiotics
aak01200  Carbon metabolism
Module
aak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AA2016_0970
  09105 Amino acid metabolism
   00310 Lysine degradation
    AA2016_0970
   00380 Tryptophan metabolism
    AA2016_0970
Enzymes [BR:aak01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AA2016_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AMS39908
UniProt: A0A142M0N8
LinkDB All DBs
Position
1018146..1021136
Genome map
AA seq 996 aa AA seqDB search
MARSDQANDQFSLTSFLYGGNADYIEALHAAYLDDPEAVDQEWRDFFGALKDDAGDIRKN
AKGASWSTPSWPLQANGELVSALDGNWGMVEKLIEKKVKDKAVATTGAEPSKADVLQATR
DSVRAIMMIRAYRMRGHLHANLDPLGIAKPLEDYNELSPEAYGFTAADYDRPIFIDHVLG
LEYATIREMLEILKRTYCSTLGVEFMHISDPEEKAWIQARIEGPDKAIEFTPEGKKAILS
KLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGSLGLKEVVLGMAHRGRLN
VLTNVMAKPHRAVFHEFKGGSYAPDDVEGSGDVKYHLGASSDREFDGNKVHLSLTANPSH
LEIVDPVVMGKARAKQDQLFGRARGEIVPQEERAKVMPLLLHGDAAFAGQGVIAEILGLS
GLRGHRVAGTLHFIINNQIGFTTNPRFSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVFAA
KVATEFRMKFHKPVVVDMFCYRRFGHNEGDEPAFTQPIMYRNIRTHKTTVQTYADKLMAE
GLMNQAEVDKMRADWRGFLEAEFEAGQAYKPNKADWLDGAWSGMRTADNQDEQRRGKTAV
PVKTLKEIGKKLTEVPKDFEVHRTIGRFLENRRQAIESGEGIDWATAESLAFGSILLDGN
PIRLSGQDSERGTFSQRHTVLYDQRDENRYIPLNNLSAAQAGYEVINSMLSEEAVLGFEY
GYSLAEPKALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEH
SSARLERFLQLCAEDNMQVANVTTPANYFHILRRQLKRDFRKPLILMTPKSLLRHKRAVS
SLSEISGESSFHRLLWDDAQYLGDQPIKLVKDSKIRRVVLCTGKVYYDLYEEREKRGIDD
IYLLRVEQLYPFPAKALITELSRFRNAEMVWCQEEPKNMGAWSFIDPYLEWVLAHIDAKH
QRVRYTGRPAAASPATGLMSKHLAQLQAFLDDALGE
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atggcacgatccgatcaggccaacgaccaattttccctcacctcgttcctctatggcggc
aatgccgactacatcgaggcgctgcacgccgcctatctcgacgaccctgaagcggtcgac
caggagtggcgcgacttcttcggcgcgctgaaggacgacgccggcgacatccgcaagaac
gccaagggcgcctcgtggtcgacgccgagctggccgctgcaggccaatggcgaactggtt
tccgcgctcgacggcaactggggcatggtcgagaagctgatcgagaagaaggtcaaggac
aaggctgtcgccacaaccggcgccgagccgtccaaggccgacgtgctgcaggcgacgcgc
gactcggtgcgcgccatcatgatgatccgcgcctaccgcatgcgcggccacctgcacgcc
aatctcgacccgctcggcatcgccaagccgctcgaggattataacgagctgtcgcctgag
gcctatggcttcaccgccgccgattacgaccggccgatcttcatcgaccatgtgctgggc
ctcgaatacgcgaccatccgcgagatgctcgagatcctgaagcgcacctattgctcgacg
ctcggcgtcgagttcatgcatatctccgatcccgaggaaaaggcctggatccaggcccgc
atcgaaggtccggacaaggcgatcgagttcacgcccgagggcaagaaggcgatcctgtcg
aagctaatcgaggccgagggcttcgagcagttcatcgacgtcaagtacaagggcaccaag
cgtttcggcctcgacggcggcgagtcgctgatccccgcgctcgagcagatcgtcaagcgc
ggcggctcgctcggcctcaaggaggtcgtgctcggcatggcccatcgcggccgcctcaat
gtcttgaccaacgtcatggccaagccgcatcgcgccgtgttccacgaattcaagggtggc
tcctacgcgcctgacgacgtcgagggttcgggcgacgtgaaataccaccttggtgcctcg
tcggaccgcgagttcgacggcaacaaggtccatctgtccttgaccgccaacccctcgcat
ctcgagatcgtcgatccggtggtgatgggcaaggcacgcgccaagcaggaccagcttttc
ggtcgcgcccgcggcgagatcgtaccgcaggaagagcgcgccaaggtgatgccgctgctg
ttgcacggcgatgcggcattcgccggccagggcgtgatcgccgaaatcctcggcctgtcg
ggcctgcgtggtcatcgcgtcgccggcacgctgcacttcatcatcaacaaccagatcggc
ttcacgacgaacccgcgcttctcgcgctcgtcgccctatccgtccgacgttgccaagatg
atcgaggcgccgatcttccacgtcaacggcgacgatccggaagcggtggtgttcgcggcc
aaggtcgcgaccgagttccgcatgaagttccacaagccggttgtcgtggacatgttctgc
taccgccgcttcggccacaacgaaggcgacgagcctgccttcacgcagccgatcatgtac
cgcaacattcgcacccataagaccacggtgcagacctatgccgacaagctgatggccgaa
ggcctgatgaaccaggccgaggtcgacaagatgcgcgccgactggcgcggcttcctcgaa
gccgagttcgaggcgggccaggcctacaagccgaacaaggccgactggcttgatggcgcg
tggtcgggcatgcgcacggccgacaaccaggacgaacagcgccgcggcaagaccgcggtg
ccggtcaagacgctgaaggaaatcggcaagaagctgaccgaggtgccgaaggacttcgaa
gtccaccgcaccatcggccgcttcctcgaaaaccgccgccaggcgatcgaatcgggcgaa
ggcatcgactgggcaacggcggaatcgctggcgttcggctcgatcctgctcgacggcaat
ccgatccgcctgtcgggccaggattccgagcgcggcacgttctcgcagcgccacaccgtg
ctctacgatcagcgtgacgaaaaccgctacatcccgctcaacaatttgtcggcggcgcag
gccggttacgaggtcatcaactcgatgctctcggaagaagccgtgcttggcttcgaatat
ggctactcgctcgcagagcccaaggcgctgacgctgtgggaagcgcagttcggcgacttc
gccaacggcgcccaggtggtgttcgaccagttcatctcgtctggcgaacgcaagtggctg
cgcatgtcgggtctcgtctgcctcttgccgcacggctatgaaggccagggccccgagcac
tcgtcggcgcgcctcgagcgcttcctgcagctctgcgccgaagacaacatgcaggtggcc
aatgtcaccacgccggccaactacttccacatcctgcgccggcagctgaagcgcgacttc
cgcaagccgctgatcctgatgacgccgaagtcgctgctgcgccacaagcgtgccgtgtcg
tcgctgtcggagatctcgggcgagagctcgttccaccgtctcttgtgggacgacgcccag
tatctcggcgatcagccgatcaagctggtcaaggactcgaagatccgccgcgtcgtgctg
tgcaccggcaaggtctattacgacctctacgaggagcgcgagaagcgcggtatcgacgac
atctatctgttgcgcgtcgagcagctctatccgttcccggcgaaggcgctgatcaccgag
ctcagccgcttccgcaacgccgaaatggtgtggtgccaggaagagcccaagaacatgggc
gcgtggtcgttcatcgacccgtatctggaatgggtgctcgcccatatcgacgccaagcac
cagcgcgtgcgctacaccggccgtccggctgccgcctccccggcgacgggcctgatgtcc
aagcacctggcgcagctccaggcattcctcgacgacgccctcggcgaataa

DBGET integrated database retrieval system