KEGG   Aminobacter aminovorans: AA2016_1081Help
Entry
AA2016_1081       CDS       T04343                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
aak  Aminobacter aminovorans
Pathway
aak00010  Glycolysis / Gluconeogenesis
aak00620  Pyruvate metabolism
aak01100  Metabolic pathways
aak01110  Biosynthesis of secondary metabolites
aak01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AA2016_1081
   00620 Pyruvate metabolism
    AA2016_1081
Enzymes [BR:aak01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AA2016_1081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AMS40019
UniProt: A0A142M0Z9
LinkDB All DBs
Position
1125506..1127023
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRTAKVPFAKRYDNYIGGAWVAPKAGRYFENISPVTGRPLGEVARSDAADIEAA
LDAAHKAKDAWGKTAPATRALILNRIADRMEENLDLLALAETWDNGKPIRETTVADVPLA
IDHFRYFAGALRGQEGSLSQIDDDTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALAA
GNCVVLKPAEQTPATIMLWADLIGDLLPEGVLNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFQDVTAEDDDFFDKAIEGFVMFALNQGEVC
TCPSRALVHEKIYDRFMERALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYMDIGRQ
EGAELLAGGERANLPGDLAGGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKDDDDALS
IANDTLYGLGAGIWSRDANRLYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETH
KMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtggaattctcgcgtaccgccaaggtgccgtttgccaagcgttatgacaac
tatatcggcggtgcctgggtagcgccgaaggccggccgctatttcgaaaacatctcgcct
gtcacaggccggccgctcggcgaggttgcccgctccgatgcggccgacatcgaggcggca
ctcgacgccgcccacaaggccaaggacgcctggggcaagacagcacctgcgacccgcgcg
ctgatcctcaatcgcatcgccgatcgtatggaggaaaacctcgaccttctggcgctggcc
gagacctgggacaatggcaagccgatccgcgagacgaccgtcgccgacgtgccgcttgcc
atcgaccatttccgctacttcgccggcgcgctgcgcggccaggaaggcagcctgtcgcag
atcgacgacgacactgtcgcctatcacttccacgagccgctcggcgtcgtcggccagatc
attccgtggaacttcccactgctgatggcctgctggaagctggcaccggcgctcgctgcc
ggcaactgcgtggtgctgaagccggctgagcagacgcccgccaccatcatgctgtgggcc
gacctgatcggcgacctgttgcccgagggcgtgctgaacatcgtcaacggcttcggcctc
gaggccggcaaaccgctggcgtcgagcccgcgcatcgccaagatcgccttcaccggggaa
acgacgaccggccggctgatcatgcaatatgcctcgcagaacctgatcccggtgacgctc
gaacttggcggcaagtcgcccaacatcttcttccaggacgtgacagcggaagacgacgac
ttcttcgacaaggcgatcgaaggcttcgtcatgttcgcgctcaaccagggcgaggtctgc
acctgcccgagccgcgcgctggtgcatgagaagatctacgacaggttcatggagcgggcg
ctgaagcgcgtcgaggcgatcgtccagggcgacccgctcgacccggcgacgatgatcggc
gcccaggcttcgtcggagcagctggagaagatcctgtcctacatggacatcggccgccag
gaaggcgccgagctgctggccggcggtgaacgcgccaacctgccgggcgaccttgccggc
ggctattacgtcaagccgaccgtgttcaggggccacaacaagatgcgcatcttccaggag
gagattttcgggccggttgtctcggtcaccaccttcaaggacgatgatgacgcgctgtcg
attgccaacgatacgctctatggcctcggcgccggaatctggagccgcgacgccaaccgg
ctctaccgcttcggccgcgccattcaggccggccgcgtctggaccaactgctaccacgcc
tatccggcgcacgctgccttcggcggttacaagcagtcgggcatcggccgcgagacgcac
aagatgatgctcgaccactaccagcagaccaagaacatgctggtcagctacagcccgaag
aagctcgggtttttctga

DBGET integrated database retrieval system