KEGG   Aminobacter aminovorans: AA2016_1748Help
Entry
AA2016_1748       CDS       T04343                                 

Definition
(GenBank) Glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
aak  Aminobacter aminovorans
Pathway
aak00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:aak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AA2016_1748
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aak02000]
    AA2016_1748
Enzymes [BR:aak01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AA2016_1748
Transporters [BR:aak02000]
 Other Transporters
  Pores ion channels [TC:1]
   AA2016_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AMS40679
UniProt: A0A142M2V9
LinkDB All DBs
Position
1797196..1797822
Genome map
AA seq 208 aa AA seqDB search
MITFYHAPWSRASNVLWLLEELGTPYTVEKVDIRAPGGVPEEYRSIQPNKKVPAIIHDGI
LVTERAAICTYLCDVFPEAGLAPAIGDKLRAPYLTWLVYADSVFDPVLAAKAHGHEFMGS
GYSYGSFSEMVDNLERTLSSRPYIAGDRFTAADTQIGGGINFGIRVLKTLPEKPVFLDYV
ERLAARPAFQRASQKDFAMAQEAGMVPG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccttttaccacgcgccctggtcgcgcgcgtccaacgtgctttggctgcttgag
gaactcggcaccccctacacggtcgagaaggtcgatatccgtgcacctggcggggtgccg
gaagagtatcgttcgatccagcccaacaagaaggtaccggcgatcatccacgatggcatc
ctggtcaccgagcgggcggcaatctgcacctatctctgtgatgtcttccccgaagccggc
cttgcacctgccataggcgataagctgcgcgcgccttacctgacctggctcgtctatgcc
gattcggtgttcgacccagtgctggcggccaaggcgcatggtcacgaattcatgggcagc
ggctattcctacggttcgttcagcgagatggtcgacaatctcgaaaggacgctgtcctcg
cgcccctacatcgcaggcgaccgcttcaccgcagctgacacccagatcggcggcggcatc
aatttcggcatccgtgtgctgaagacgctgcccgagaagccggtgttcctggactatgtc
gagcgcttggcagcacgccccgccttccagcgcgccagccagaaggattttgcgatggcg
caggaggcgggcatggttcccggctga

DBGET integrated database retrieval system