KEGG   Aminobacter aminovorans: AA2016_2370Help
Entry
AA2016_2370       CDS       T04343                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
aak  Aminobacter aminovorans
Pathway
aak00240  Pyrimidine metabolism
aak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aak00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AA2016_2370
Enzymes [BR:aak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     AA2016_2370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 DUF3331 AAA_30
Motif
Other DBs
NCBI-ProteinID: AMS41296
UniProt: A0A142M4M6
LinkDB All DBs
Position
complement(2427000..2427614)
Genome map
AA seq 204 aa AA seqDB search
MAKLYFHYATMNAGKTTMLLQASYNYRERGMTTMLFVAGHYRKGDTGYISSRIGLEAGAE
MFRGGDDLYARIAEHHQHTTVHCIFVDEAQFLEEEQVWQLARVADRLGIPVMCYGLRTDF
QGNLFSGSRALLAIADDLREVRTICRCGRKATMVVRLGPDGKVARQGEQVAIGKDVYVSL
CRRHWEEEMGRAQPDDFIGFATPS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttccattacgccacgatgaatgccggcaagacgaccatgctgctg
caggcgtcctacaactaccgcgagcgcggcatgacgacgatgctgtttgtcgccggccac
taccgcaagggcgacaccggctacatctcctcgcgcatcgggcttgaagcaggcgccgag
atgttccgcggcggcgacgacctctatgcccgcatcgccgagcatcatcagcacacgacc
gtccactgtatctttgtcgacgaggcgcagttcctcgaggaagagcaggtctggcagctt
gcgcgcgtcgccgacaggctgggcattcccgtcatgtgctacgggctgcgcaccgacttc
cagggcaatctgttctcgggctcgcgggcgctgctcgccatcgccgacgacctgcgcgag
gtgcgcacgatctgccgctgcggccgcaaggcgacgatggtcgtgcggctcggcccggac
ggcaaggtcgcccgccagggcgagcaggtggcgatcggcaaggacgtctacgtctccttg
tgtcggcgccactgggaagaggaaatgggccgcgcccagcccgacgacttcatcggattt
gccacaccaagctaa

DBGET integrated database retrieval system