KEGG   Aminobacter aminovorans: AA2016_2811Help
Entry
AA2016_2811       CDS       T04343                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aak  Aminobacter aminovorans
Pathway
aak00473  D-Alanine metabolism
aak00550  Peptidoglycan biosynthesis
aak01100  Metabolic pathways
aak01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AA2016_2811
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AA2016_2811
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AA2016_2811
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aak01011]
    AA2016_2811
Enzymes [BR:aak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AA2016_2811
Peptidoglycan biosynthesis and degradation proteins [BR:aak01011]
 Precursor biosynthesis
  Amino acid ligase
   AA2016_2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 GARS_A ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AMS41736
UniProt: A0A142M5W6
LinkDB All DBs
Position
2882670..2883596
Genome map
AA seq 308 aa AA seqDB search
MKSKHVAVLMGGFSSERPVSLSSGNACAEALEQVGYQVTRVDVDRDVGAVLSTLKPDVAF
NALHGPFGEDGTIQGILEYLGIPYTHSGVLASALAMNKEQSKKVAKAAGIPIAESRVLDR
FAIGNQHPMKPPYVVKPVSEGSSFGVVIVKEDQSHPPQVISSSEWRYGDTVMVERYVHGR
ELTCAVMGDVALGVCEIVPTGHAFYDYDSKYVAGGSKHECPAKVSPNIYQKIQTLALKAH
QAIGCRGVSRSDFRYDDRHSENGEVVWLEVNTQPGMTPTSLVPEIAAQAGHSFGELLSWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaaagcacgtcgctgtcctgatgggcgggttttcgtccgagcggcctgtgtcc
ctgtcgtctggcaatgcctgtgccgaagcgctcgagcaggtcggttatcaggtcacgcga
gtggacgtcgatcgcgatgtcggcgcagtgctttcgacgctcaagccggatgtcgcattc
aacgccctgcatggccccttcggcgaagacggcaccatccagggcatcctcgaatatctc
ggcattccctacacccattccggcgtgctggcctcggcactggcgatgaacaaggagcag
tcgaagaaggtggccaaagctgccggcattccgattgccgaatccagggttctcgaccgt
tttgccatcggcaaccaacacccgatgaagccgccttacgtggtcaagccggtgtccgaa
gggtcgagcttcggtgtcgtcatcgtcaaggaagaccagtcgcatccgccgcaggtcatc
tcctcatccgagtggcgctacggcgacacggtgatggtcgagcgttacgtccatggtcgt
gagttgacctgtgccgttatgggtgatgttgcgcttggcgtctgcgagatcgttccgacc
ggtcacgccttctacgattatgattcaaaatatgtcgccggcggatcaaagcacgaatgc
cccgcgaaagtttcaccgaatatttaccaaaaaatacaaacactggcgctcaaggctcac
caagcgatcgggtgccggggcgtctcccggtctgacttccggtacgacgaccgccattcc
gaaaatggagaggtcgtctggctggaggtcaacactcaacccggcatgacgccgacgtcg
ctggtgcctgagattgcagcccaagccgggcattcgtttggtgagttgttgagttggatg
gtggaggacgcttcgtgtttgcgttga

DBGET integrated database retrieval system