KEGG   Aminobacter aminovorans: AA2016_3484Help
Entry
AA2016_3484       CDS       T04343                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
aak  Aminobacter aminovorans
Brite
KEGG Orthology (KO) [BR:aak00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:aak03012]
    AA2016_3484
   03029 Mitochondrial biogenesis [BR:aak03029]
    AA2016_3484
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aak04147]
    AA2016_3484
Translation factors [BR:aak03012]
 Eukaryotic Type
  Elongation factors
   AA2016_3484
 Prokaryotic Type
   AA2016_3484
Mitochondrial biogenesis [BR:aak03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AA2016_3484
Exosome [BR:aak04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AA2016_3484
  Exosomal proteins of breast cancer cells
   AA2016_3484
  Exosomal proteins of colorectal cancer cells
   AA2016_3484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AMS42406
UniProt: A0A142M7V4
LinkDB All DBs
Position
3557544..3558719
Genome map
AA seq 391 aa AA seqDB search
MAKGKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPALVVFLNKVDLVDDAELLELVELEVRELLSKYEYPGDDIPMIKGSAVAALNDSDKK
IGEDAIRALMEAVDAYIPTPERPIDRPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIKATSKTTVTGVEMFRKLLDQGQAGDNIGALIRGVGREDVERGQVLCKPGSVKPHK
KFVAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVSLPEGTEMVMPGDNITVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIKE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattcgagcgtaacaagcctcacgtgaacatcggcacgattggtcac
gttgaccacggcaagacgtcgctgactgctgcgatcacgaagtatttcggcgagttcaag
gcctacgaccagatcgacgcagcgccggaagagaaggcccgcggcatcacgatctcgacg
gcgcacgtcgagtatgagacgccggcccgtcactacgcccacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgctgcccagatggacggcgcgatcctggtc
gtgtcggctgctgacggcccgatgccgcagacccgcgagcacatcctgctcgcccgtcag
gttggcgttcccgccctggtggtgttcctgaacaaggtcgaccttgtcgacgacgccgag
ctgctcgaactggtcgagctcgaggttcgcgagctgctgtcgaagtacgaatatccgggc
gacgacattccgatgatcaagggttcggctgttgctgcgctcaacgattcggacaagaag
atcggtgaagacgcgatccgcgcgctgatggaagccgtcgacgcctacatcccgacgccg
gagcgtccgatcgaccgtccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgtggcactgtcgtcaccggtcgcgtcgagcgcggcatcgtcaaggttggcgaagaagtc
gagatcgtcggcatcaaggcaacctcgaagacgacggttaccggcgttgaaatgttccgc
aagctgctcgatcagggccaggctggcgacaacatcggcgcgctgatccgcggcgttggc
cgtgaagacgtcgagcgcggccaggtgctgtgcaagccgggttcggtgaagccgcacaag
aagttcgtggctgaagcctacatcctgaccaaggaagagggtggccgtcacacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgaccggcatcgtgtcg
ctgccggaaggcaccgagatggtcatgcccggcgacaacatcaccgtcgacgtcgagctc
atcgtgccgatcgccatggaagagaagctccgcttcgctatccgtgaaggtggccgcacc
gtcggcgccggcatcgtcgcttcgatcaaagaataa

DBGET integrated database retrieval system