KEGG   Aminobacter aminovorans: AA2016_4860Help
Entry
AA2016_4860       CDS       T04343                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aak  Aminobacter aminovorans
Pathway
aak00061  Fatty acid biosynthesis
aak00780  Biotin metabolism
aak01100  Metabolic pathways
aak01130  Biosynthesis of antibiotics
aak01212  Fatty acid metabolism
Module
aak_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AA2016_4860
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AA2016_4860
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AA2016_4860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aak01004]
    AA2016_4860
Enzymes [BR:aak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     AA2016_4860
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     AA2016_4860
Lipid biosynthesis proteins [BR:aak01004]
 Fatty acid synthase
  Component type
   AA2016_4860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AMS43769
UniProt: A0A142MBP9
LinkDB All DBs
Position
complement(4966595..4967413)
Genome map
AA seq 272 aa AA seqDB search
MAGGQGLMAGKRGLILGVANNRSIAWGIAKACADQGAELAFTYQGDALKKRVEPLAAEIG
AFVCGHCDVTDMATIDACFETLEKKWGKLDFVVHAIGFSDKDELTGRYVDTSHANFLRTM
DISVYSFTAVAQRAEKLMTDGGSMLTMTYYGAEKVMPNYNVMGVAKAALEASVKYLAVDL
GPKAIRVNAISAGPIKTLAASGIDDFRYILKWNEYNAPLRRTVSIEEVGDSALYFLSNLS
RGVTGEVHHVDSGYHVVGMKAVDAPDIAAVKD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtggacagggcctgatggccggcaagcgcggccttattctcggcgtcgccaac
aacagatcgattgcctggggaattgccaaggcctgcgccgaccagggcgcggagcttgcc
ttcacctatcagggcgatgcgctgaagaagcgcgtcgagccgctggccgccgaaatcggc
gcgttcgtctgcggacattgcgacgtcaccgacatggccaccatcgatgcctgcttcgag
acgctggaaaagaagtggggcaagctcgacttcgtcgtccatgccatcggcttctccgac
aaggacgagctgaccggccgatatgtcgacaccagccatgccaacttcctgcgcaccatg
gacatctcggtctattccttcaccgctgtcgcccagcgcgccgagaagctgatgaccgat
ggcggctcgatgctgaccatgacctattacggcgccgaaaaggtgatgccgaactacaat
gtcatgggcgttgccaaggcagctctcgaggcgagcgtgaagtatctcgccgtcgacctc
ggcccgaaggcgatccgcgttaacgcgatttccgccggcccgatcaagacgcttgccgcc
tccggcatcgacgacttccgctacattctgaagtggaacgagtacaacgcgccgctgcgc
cgcaccgtttcgatcgaggaggtcggcgattctgcgctctacttcctgtcgaacctgtcg
cgcggcgtcaccggcgaagtgcaccacgtcgattccggctaccacgtcgtcggcatgaag
gccgtcgatgcgcctgacatcgcagccgtgaaggactga

DBGET integrated database retrieval system