KEGG   Aminobacter aminovorans: AA2016_5311Help
Entry
AA2016_5311       CDS       T04343                                 

Definition
(GenBank) PhoU family transcriptional regulator
  KO
K02039  phosphate transport system protein
Organism
aak  Aminobacter aminovorans
Brite
KEGG Orthology (KO) [BR:aak00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AA2016_5311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoU Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AMS44217
UniProt: A0A142MCZ7
LinkDB All DBs
Position
complement(5425098..5425823)
Genome map
AA seq 241 aa AA seqDB search
MQSQHIVSAYDDELKFLARKIAAMGGQAERMVDQAIAALVNADPALGQRVIQDDIVLDEA
QREIDDKAILIIARRQPMATDLREIVGAIRISADLERVGDLGKNIAKRVLAVAEGRQPNS
LFRGLEALAELALTQLKEVLDVYASRSVERIGFVRDRDEQIDAMYTSLFRELLTYMMEDP
RNITPCTHLLFVAKNIERIGDHATNIAETIYYIVTGEQMPPERPKEDKSHRVTLEGEGKS
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcacaacacattgtcagtgcctacgacgacgagctgaaattcctggcgcggaag
atcgccgcgatgggcggccaggctgagcgtatggtcgatcaggcgatcgccgctctggtc
aatgccgacccggcacttggccagagggtgatccaggacgacatcgtgctcgacgaggcc
cagcgcgagatcgacgacaaggcgatcctgatcatcgccaggcgccagccgatggcgacc
gacctgcgcgagatcgtcggcgcgatccgtatctcggccgatctcgaacgcgttggcgac
cttggcaagaacatcgccaagcgcgtgctggcggtggccgagggccggcaacccaacagc
ctgttccgcggcctggaggcgttggcggaactcgcgctgacccagctcaaggaagtactc
gacgtctacgcctcgcgttcggtcgagcgtatcggcttcgtgcgcgaccgcgacgagcag
atcgacgccatgtacacctcgctgttccgcgagcttttgacctacatgatggaagatccg
cgcaacatcaccccgtgcacgcacctgctgttcgtcgccaagaacatcgagcgcatcggt
gaccacgccaccaacattgccgagacgatctattacatcgtcaccggagagcagatgccg
cccgagcgccccaaggaagacaagagccatcgcgtgacgctggaaggcgagggaaagtcg
ggctga

DBGET integrated database retrieval system