KEGG   Aminobacter aminovorans: AA2016_5813Help
Entry
AA2016_5813       CDS       T04343                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aak  Aminobacter aminovorans
Pathway
aak00620  Pyruvate metabolism
aak00680  Methane metabolism
aak01100  Metabolic pathways
aak01120  Microbial metabolism in diverse environments
aak01200  Carbon metabolism
Module
aak_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AA2016_5813
  09102 Energy metabolism
   00680 Methane metabolism
    AA2016_5813
Enzymes [BR:aak01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AA2016_5813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMS44718
UniProt: A0A142MEE8
LinkDB All DBs
Position
pAA01:327858..330566
Genome map
AA seq 902 aa AA seqDB search
MNGCRLEESRPLSFREDVRSLLFRVLLSVVSEREPDMAEVLTGRVSLDALESGQRIAALQ
ATGIWFQLVAIANELLAMRSRRELEQMGGADEVIGSFANVMGEIAAGGYPAEQIQTTLEE
LCVGPTMTAHPTEAKRVTVLEIHRRIYRKLTELEQQRWAPREREQLIDDLKSEIELLWMS
GELRLERPSVEREIAWGLHFFREVIFEATPKLYDSVEEALARHYPEYDIKVPSFMRYASW
IGGDRDGNPNVTAKITAYALNECRQAIVGWYIGQVRKLVTVLSISANVVDIPDTFIKALG
HALHRSGNASEIVARNPDEPLRQFAGAMLDRLEAMRGAASAKPYTRSEGFKTDLRELENV
LTQLGGKLIARRFVRPLRQQVETFGFRTVSLDIRQNSTVVNRVLAELFKLADPAAAPAPD
TPQWTQRIRAALNSGEQLEVDRLALSEEAQELLDLFDVIRKASAGLNGGAVGAFILSMTR
SSDDLLAVYLLAQYSGLATAMDGSGTIALRVVPLFETIADLRAAPDILDQLFGVSIVRRS
VRDFGNRQEVMLGYSDSNKDGGFLASNWELNKAQRRITALGIKRKVKISFFHGRGGSVSR
GGAPTGRAIAAQPAGTIGGAMRVTEQGEVVSSKFANRGTGLYQLEILAASVFAHSVKSQN
EAELKDIPEFSEALEALTGMSQASYSGLINEPGFIDYFNQASPVEELALLKIGSRPARRF
GARDISDLRAIPWVFAWSQNRHLLTNWYGIGSALNSFVNVRGDAGLDLLRQMFERSRFFR
LVIDEVDKGLYQSDMDIGKLYAGLVQDREVGERIYAKISAEYALTRRMISEVNGGLKLSE
RFPAFKRHFDRIRPQMDSIHRLQVQLLREVRAQDDATVNPKRAVNALLLSINCISAGLGW
TG
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaatgggtgtcgcttggaggagagcagaccactcagctttcgcgaagacgtgcgcagc
ctgctgttcagggtgctgctttctgtcgtcagcgaacgcgagcccgatatggcggaggtt
cttaccggccgcgtgagccttgatgcgctcgaaagcgggcaacgcattgccgcgctgcag
gccaccggcatctggttccagcttgttgccatcgccaatgaacttctggcgatgcgctcg
cgtcgcgaactcgaacagatgggcggggccgacgaggtcatcggctcttttgccaatgtg
atgggcgaaatagcagccggcggctacccggccgagcagatccagactaccctcgaagag
ctctgcgtcggcccgacgatgacggcgcatccgaccgaggccaagcgcgtcacggttctc
gaaatccaccgccgcatctaccgcaagctgaccgagctcgagcagcaacgttgggcgccg
cgtgaacgcgaacagctgatcgacgatctcaagagtgagatcgagctgttgtggatgtcg
ggcgagctgcggctcgagcgcccgtcggtcgagcgcgagatcgcctggggcctgcacttc
ttccgcgaagtgatcttcgaagcgacgcccaagctctatgacagcgtcgaagaggcgctg
gcccgtcactatcccgaatacgatatcaaggtgccgtccttcatgcggtacgcctcgtgg
atcggtggcgaccgcgacggcaatccgaacgtcacggcaaagatcacggcctatgcgctc
aacgagtgccgccaggcgatcgtcggctggtacatcggccaggtgcgcaagcttgtcacc
gtgctcagcatcagcgccaatgtcgtcgacattcccgataccttcatcaaggcgcttggg
catgcgctgcatcgctccggcaatgcctcggagatcgtggcgcgcaatcccgacgagccg
ctgcgccagttcgccggtgccatgctcgaccggctggaggcaatgcgcggcgcagcctct
gccaagccttatacccgatcggaaggcttcaagaccgacctgcgtgagcttgaaaacgtg
ctgacccagcttggcggcaagctcatcgccagacgcttcgtccgaccgctgcgccagcag
gtggagactttcggcttccgtaccgtttcgctcgacatccgccagaattcgacggtggtg
aaccgtgtgctggcagagctgttcaagctcgccgacccggccgcggcaccggcacccgac
acgccgcaatggacgcagcgtatcagggcggcgctcaactccggcgagcagctggaggtt
gacaggctggcgctgtcggaggaagcgcaggagctgctcgatctgttcgacgtcatccgc
aaggcttcggccggcttgaatggtggcgctgtcggtgccttcatcctgtcgatgacccgg
tcgagcgacgatctgctcgccgtctatctgctggcacaatattccggccttgcaacggcc
atggatggcagtggcaccatcgcgctgcgtgtcgttccgctgttcgaaaccatcgccgat
ctgcgtgccgcgccagacattctcgatcagctgttcggcgtctcgatcgttcgccggtcg
gttcgtgacttcggcaaccgccaggaggtgatgctcggctattccgactcaaacaaggac
ggcgggttcctcgcttccaactgggagctcaacaaggcacagcggcgcatcacggcactt
ggcatcaagcgcaaggtcaagatcagcttcttccatggccgcggcggttcggtcagccgc
ggcggtgcgccgacgggcagggcgatcgccgcccagccggcggggaccattggcggcgcg
atgcgcgtcaccgagcagggcgaggtggtgtcgtccaagttcgccaatcgcggcaccggg
ctctatcagctcgagatcctcgccgcgagcgtcttcgcccacagcgtcaagtcgcagaac
gaggccgaactcaaggacattccggagttcagcgaggctctggaagcgctcaccggcatg
tcccaggcgtcctattcggggctgatcaacgagccgggcttcatcgactacttcaatcag
gcgagcccggtcgaggagctggcgctgctcaagatcggctcgcgtccagcccgccgcttc
ggcgcccgcgacatctccgatcttcgcgccatcccttgggtgttcgcctggagccaaaac
cgccacctgctgaccaactggtatggcatcggcagtgcgctgaactccttcgtcaatgtc
cgcggcgatgccggcctggatctgctcaggcagatgttcgagcgctcgcgcttcttcagg
ctggtcatcgacgaggtcgacaagggtctctaccaatccgacatggacatcggaaagctc
tatgccgggctggtccaggaccgcgaggtcggcgagcgcatctatgccaagatctcggct
gagtatgcgctgaccaggcggatgatctccgaggtcaatggcggcctgaaattgtccgag
cgctttccggccttcaagcgccatttcgaccgcatccgcccgcagatggactcgatccat
cggctgcaggtgcaactgctgcgcgaggtgcgcgcccaggacgacgcgaccgtcaacccg
aagcgggccgtcaatgcgcttctgctttccatcaattgcatttccgccggtctcggctgg
accggatga

DBGET integrated database retrieval system