KEGG   Aminobacter aminovorans: AA2016_5902Help
Entry
AA2016_5902       CDS       T04343                                 

Definition
(GenBank) hypothetical protein
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
aak  Aminobacter aminovorans
Pathway
aak00061  Fatty acid biosynthesis
aak00780  Biotin metabolism
aak01100  Metabolic pathways
aak01130  Biosynthesis of antibiotics
aak01212  Fatty acid metabolism
Module
aak_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:aak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AA2016_5902
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AA2016_5902
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AA2016_5902
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aak01004]
    AA2016_5902
Enzymes [BR:aak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     AA2016_5902
Lipid biosynthesis proteins [BR:aak01004]
 Fatty acid synthase
  Component type
   AA2016_5902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AMS44807
UniProt: A0A142MEN7
LinkDB All DBs
Position
pAA01:419638..420393
Genome map
AA seq 251 aa AA seqDB search
MFELDLRGRRIVIAGGSRGLGLHVALAFAEAGASVSICARGKGDLEAAGERIAMHGVTSH
AAYCDLTDLSSIKAYVEEAANKLGGIDILINNATGKASSDTEQDWAASLSVDVLATVRAS
SAAQPYLENGTNPAIINISSRTAFAPAPTTPAYGAAKAAIMHFTWSQAAALAGKGIRVNC
VAPGSLEFPGGWWDKCRVQNPALYDRTLTSFPFGRFGTPGDIANVVLFLASPLSGWITGQ
TLLADGGQTLQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagctcgatctcagagggcgccgtatcgtcatcgccggcggcagcagggggctt
ggcctccatgtcgcgcttgcattcgccgaggctggggcctcggtgtcgatctgcgcccgc
ggcaaaggcgaccttgaagctgccggagaaaggatcgcaatgcacggcgtcacttcccat
gcggcctattgtgatctcaccgacctttcctcgatcaaggcgtatgtcgaggaggccgca
aacaagcttggtggcatcgacatcctaatcaacaacgccaccggcaaagccagttccgac
accgaacaggactgggccgcaagcctcagtgtcgacgtactcgccactgttcgagcatca
tcggccgcgcaaccctacctggaaaacgggaccaacccggcgatcatcaacatctcctcg
cgcactgctttcgcacccgctccgaccacaccggcctatggggccgcaaaggcggcgatc
atgcatttcacctggtcgcaggccgcagcccttgccggcaagggcattcgcgtcaactgc
gttgccccgggctccctggaatttcctggcggatggtgggacaaatgccgggttcagaac
ccggcgctctacgacaggacgctgacgagttttccctttggccgcttcggcacgcccggg
gacatcgcaaacgtagtcctgttcctcgcctcgccattgagcgggtggatcaccggccag
accctgctcgccgacggcggccagacactgcaatag

DBGET integrated database retrieval system