KEGG   Aminobacter aminovorans: AA2016_6337Help
Entry
AA2016_6337       CDS       T04343                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
aak  Aminobacter aminovorans
Pathway
aak03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:aak00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AA2016_6337
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aak03400]
    AA2016_6337
Enzymes [BR:aak01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AA2016_6337
DNA repair and recombination proteins [BR:aak03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AA2016_6337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AMS45233
UniProt: A0A142MFW3
LinkDB All DBs
Position
pAA02:368434..371031
Genome map
AA seq 865 aa AA seqDB search
MALETYRKKRNFGATPEPKGRQGRRRGNSFVVQKHDATRLHYDFRLEMDGVLKSWAVTKG
PSLSPVDKRLAVHVEDHPLAYGDFEGTIPKGEYGGGTVIVWDRGSWTPIGDGADGYAKGQ
LDFELDGEKLHGRWHLVRMRGKPREKRENWLLIKGDDKFARDNGEDVLDELPLSVKTGRD
LAEVSGEAPGWSSKTGRIRGPKTLQHKATARKTGARKTGAQKSGTRISGAPGKAAHEAPT
AALADMPKARKAALPAFVEPALATLAASPPTGERWLHEIKFDGYRLQARLEDGDVFLLTR
SGLDWTAKFGKAVVDALAALPVTTALIDGELVVETGTGASDFSALQADLSAGRTDRFVFY
AFDLLHLEGYDLTQSPLSARKTRLEQLIPEGNGMVRYSGHFEERGSLVLRHACRLSLEGV
VSKLRDGPYRSGRCKSWIKSKCSARQEFVVAGFIPSSVSRKAIGSLILGVFDGKELHHVG
RVGTGFTEAVARQLFERLHRLEIATSPFAGRLSADERRQARFVRPELVAEVEFRAWTADG
HLRHASFRGLREDKPATEIVREIRKSGAKPPPPQRRTVKLTHPDRLYWPDEGVTKEGLAD
YYTDVWRHMAPFVVGRPLALLRCPNGITGEKFFQKHAWKGLNPNIVLIEDPKEKTGAPLI
SINDLDGLLGLVQSATLEIHPWGSTAADWEHPDMIVMDLDPGDDVSWQAVTAAAEEVRQR
LVDKGLAAFLKTSGGKGLHVVAPLKPKADWPEVKAFTKALADEMASDDPDRYVSTITKSK
RHGKILVDYLRNQRGATAVACYSTRARPGAAVSAPLSWDELGADIGPAHFTVENMPKRLE
ALASDPWEDFRAAAVPLTAKRGKAG
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgaaacctatcgcaaaaagcggaatttcggcgccacgcccgaaccgaagggg
cggcaggggcgccgcagaggcaacagcttcgtcgtccagaaacatgatgccacacgcctg
cattacgatttccggctggagatggatggtgtgctgaaaagctgggcggtcaccaaggga
cccagcctgtcgcccgtcgacaagcggctggcggtgcatgtcgaggaccatccactcgct
tatggcgatttcgaagggacgatcccgaaaggcgaatatggcggcggcaccgtgatcgtc
tgggaccgcggcagctggacgccgatcggcgacggcgcggacggctatgccaaggggcag
ctcgatttcgaactcgacggcgagaagctgcacggccgctggcatctggtgcgcatgcgc
ggaaaaccgcgcgagaagcgggaaaactggctgctgatcaagggcgacgataaatttgcc
cgcgacaatggcgaggacgtgctggacgagctgccgctgtcggtgaagacagggcgggac
ttggcggaggtctcaggcgaagctcccggctggtcgtcgaagaccgggcgcatccgtggc
cccaagaccctgcagcacaaggcaacagcacggaagactggggcacggaagactggggcc
cagaagtcggggacgcggatttcgggggcgcccggcaaggccgcgcatgaggcgccaacc
gcagcacttgccgacatgccgaaagccagaaaggcagcccttcctgccttcgtcgagccg
gctcttgcaacccttgcggcgtcgccgccgacaggcgagcgctggctacacgaaatcaag
ttcgacggttaccgcctgcaggcgcggcttgaagatggcgatgtcttcctgttgacgcgc
agcgggctcgactggacggccaaattcggcaaggcggtcgtcgacgcgctcgcagcgctg
cccgtcaccacggcactcatcgacggcgaactggtcgtcgagacgggcacgggcgcgtct
gacttctccgccctgcaggccgacctgagcgcgggccggacggatcgcttcgtcttctat
gccttcgacctgctccatcttgagggatatgacctcacccagtcgccgctctcggcacgc
aagacacggctcgagcagcttattcccgagggcaacggcatggttcgttacagcggccat
ttcgaggaacgcggcagccttgtgctgcggcacgcctgccgcctcagcctcgagggcgtg
gtgtcgaagctgcgcgatgggccctatcgcagcgggcgctgcaagtcctggatcaagtcg
aaatgctcggcgcgccaggagttcgtcgtcgccggcttcataccctccagcgtgtcgcgc
aaggccatcggctcgctcatcctcggcgtgttcgacggcaaggagcttcaccatgtcggc
cgtgtcgggaccggtttcaccgaagccgtggcaaggcagctctttgagaggctccatcgc
ttggagattgcgaccagcccatttgccggacgcctgtcggccgacgaaaggcgccaggcc
cggtttgtccggcccgagctggtggcggaagtggagttcagggcgtggaccgcggatggc
cacctgcgccacgcctcgtttcgcggcctgcgggaagacaagccggccacggaaatcgtc
cgcgaaatcagaaagtccggcgcaaagcctccgccgccgcaacgccgcaccgtcaaactc
acccatcccgaccgcctctactggcccgatgagggcgtgaccaaggaggggctggcggac
tattataccgatgtgtggcgccacatggcgccgtttgttgtcggccggccgctggcgctg
ctgcgctgcccgaacggcataacaggcgaaaaattcttccagaagcatgcctggaaaggg
ttgaacccgaacatcgtgctgatcgaggaccccaaggaaaaaaccggggcgccgctgatc
agcatcaacgacctcgatggcctgctcggcctggttcagtcggcgacgctggaaattcat
ccctggggctcgacagcagcggattgggaacatcccgacatgatcgtcatggatctcgat
ccgggagacgacgtctcctggcaggccgtcaccgcagcggccgaggaagtgcggcagcgg
ctggtcgacaaggggcttgccgccttcctgaagacgtcggggggcaagggcctgcatgtc
gtggcgccgctgaagccgaaagccgactggcccgaggtcaaggccttcaccaaggcgctt
gccgacgagatggcatcagatgatccggaccgctacgtctcgacgatcaccaagtcgaag
cgccacggcaagatcctcgtcgactatctgcgcaaccagcgcggcgcaaccgccgtcgcc
tgctactcgacccgggcccgcccgggtgctgcggtgtcggcgccgctgtcatgggatgag
ctcggcgcagacatcggaccggcccacttcaccgtcgagaacatgccgaagcgcctcgaa
gccctggccagcgacccctgggaggatttccgcgccgccgccgttccgcttacagcgaaa
cgcggaaaggccggctag

DBGET integrated database retrieval system