KEGG   Alteromonas australica H 17: EP13_02845Help
Entry
EP13_02845        CDS       T03220                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
aal  Alteromonas australica H 17
Pathway
aal00071  Fatty acid degradation
aal00280  Valine, leucine and isoleucine degradation
aal00281  Geraniol degradation
aal00310  Lysine degradation
aal00362  Benzoate degradation
aal00380  Tryptophan metabolism
aal00410  beta-Alanine metabolism
aal00640  Propanoate metabolism
aal00650  Butanoate metabolism
aal00903  Limonene and pinene degradation
aal00930  Caprolactam degradation
aal01100  Metabolic pathways
aal01110  Biosynthesis of secondary metabolites
aal01120  Microbial metabolism in diverse environments
aal01130  Biosynthesis of antibiotics
aal01200  Carbon metabolism
aal01212  Fatty acid metabolism
Module
aal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EP13_02845 (fadB)
   00650 Butanoate metabolism
    EP13_02845 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EP13_02845 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EP13_02845 (fadB)
   00310 Lysine degradation
    EP13_02845 (fadB)
   00380 Tryptophan metabolism
    EP13_02845 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EP13_02845 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EP13_02845 (fadB)
   00281 Geraniol degradation
    EP13_02845 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EP13_02845 (fadB)
   00930 Caprolactam degradation
    EP13_02845 (fadB)
Enzymes [BR:aal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EP13_02845 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EP13_02845 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EP13_02845 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     EP13_02845 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 SDH_sah
Motif
Other DBs
NCBI-ProteinID: AIF97713
UniProt: A0A075NW43
LinkDB All DBs
Position
complement(635147..637297)
Genome map
AA seq 716 aa AA seqDB search
MIYTGKSLSVSLLDDGFAELVFDAEGSVNKFDRQTVTELDEATQALLAKGDVKGLVVRSA
KSAFIVGADITEFTGLFAMDDEEVLQWVANTSQVFDRFEDLPFPTIAAVNGFALGGGCEM
ALACDMRIADTTASIGLPEVKLGLMPGFGGTVRLPRLIGADNALEWMTTGRDRKGAKALA
EGAVDAVVAPETLVEGALSMVKDAVDGKFDWQARRAVKKAPLQLNKNEAMMSFSTAQAMV
FAQAGKHYPAPHKMVETVQKASVLDREGALKLENKGFVELAKTDAAKAQIGIFLADQLVK
SKGKKQAKAATKQSKLNAVLGAGIMGGGIAYQSAVKGTPVIMKDINQGALDLGLSEAAKI
LGKGMKRGKVDATKMAQTLNAITPTLEYSTLKDADLVIEAVVENPKVKGIVLKEVEENVA
DDAIICSNTSTISINQLAESLDKPERFCGMHFFNPVHRMPLVEIIRGEKTSEETINAVVA
ATLKMGKTPIVVNDCPGFLVNRVLFPYFAGFSKLLIDGADFVAVDKVMEKIFGWPMGPAY
LMDVVGIDTGDHAADVMAAGIPERMARLDNDPVTLFYKEERLGQKNGKGFYNYGVDKRGK
PSKTPAEEAYALMAPHVAEKTDFEADDIIARLMIPMANEAIRCLEEGIVDSAAEADMALL
YGLGFPPFRGGIFRWIETIGLANFVAMADKYAELGPIYQISDGVREMAAAGKSYFA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatatacacaggcaaaagtctttccgtcagcctgttagatgacggctttgctgagctg
gtattcgacgccgaaggttcagtgaacaagttcgaccgccaaacggtaactgaacttgac
gaagcaacacaagctctgctagctaagggcgacgtaaaaggcttagtagtacgcagcgca
aaatctgcatttattgtaggtgctgatatcaccgagttcacgggccttttcgccatggac
gacgaagaggtactacagtgggttgctaatacttcacaggtattcgatcgctttgaagac
ttaccattccctaccattgctgccgttaacggctttgcattgggcggcggttgtgagatg
gcattggcatgtgacatgcgtattgcagacaccacagcttccattggtttaccagaagtt
aagctaggcctgatgcctggttttggcggtaccgttcgcttacctcgtctcattggcgca
gataatgccctagaatggatgaccactggacgtgacagaaaaggcgcgaaagcccttgct
gaaggcgcagttgacgcagtagtagcaccagaaacgttagtggaaggtgcactatcaatg
gtgaaagacgccgttgacggtaagtttgactggcaagcacgacgtgcggttaagaaagcc
ccactacagctaaacaaaaacgaagccatgatgagcttctctactgctcaagctatggtg
tttgcacaagcaggcaaacattacccagcaccgcacaaaatggtggagacagtgcaaaaa
gcctctgtactagaccgtgaaggtgcgcttaagcttgaaaataaaggctttgtagaactg
gcgaaaaccgacgcggcgaaagcccaaataggtattttccttgccgaccagcttgttaag
agcaaaggtaagaagcaagcgaaagcagccactaagcagtctaagcttaacgccgtactc
ggtgctggtatcatgggcggcggtattgcataccaaagcgccgtgaaaggcacaccagtt
attatgaaagacattaatcaaggtgcactagatcttggtctttcagaagcggcgaaaata
cttggtaaaggtatgaagcgcggtaaagttgatgcgaccaaaatggcgcagacgcttaac
gcaatcacacctaccctcgagtacagtacacttaaagatgcagaccttgttattgaagcg
gtggtagaaaacccaaaagtgaaaggtattgtacttaaagaggttgaagagaatgtcgct
gacgacgctattatctgctcaaacacctcgactatctctatcaaccagctagcagaaagc
ctagacaagccagagcgtttctgcggtatgcacttcttcaacccagtgcaccgcatgcca
ctcgttgaaattattcgcggggaaaaaacctcggaagaaaccattaatgcggtagtggct
gccacgcttaaaatgggcaaaacccctattgtggttaacgactgccctgggttcttagta
aaccgcgtattgttcccgtattttgcgggcttcagtaagctacttatcgacggcgctgac
tttgtagcggttgataaagttatggaaaaaatctttggctggccgatgggccctgcgtac
cttatggacgttgtaggtatcgacactggcgatcacgcagctgacgtaatggccgcgggt
attccagagcgtatggcgcgcctagataacgacccagtaaccttattctataaagaagag
cgtttaggtcagaaaaacggtaaaggtttctacaactacggtgttgataagcgcggcaag
ccgtctaaaacacctgctgaagaagcctacgcactcatggcgccacacgtagctgaaaag
acagactttgaagctgacgacattattgcacgcctaatgatccctatggcaaacgaagca
attcgctgcctagaagaaggcattgtagatagcgcagctgaagctgacatggcgctactt
tacggcttaggtttccctccattccgcggtggtattttccgttggattgaaaccattggc
ttggcgaactttgttgcgatggcagacaagtacgctgaacttggtccaatttaccagatt
tcagatggcgttcgtgaaatggccgctgctggtaaatcctatttcgcataa

DBGET integrated database retrieval system