KEGG   Alteromonas australica H 17: EP13_08760Help
Entry
EP13_08760        CDS       T03220                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aal  Alteromonas australica H 17
Brite
KEGG Orthology (KO) [BR:aal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EP13_08760
Enzymes [BR:aal01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EP13_08760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like FAD_binding_2 GIDA FAD_oxidored DAO Thi4 AlaDh_PNT_C Lycopene_cycl NAD_binding_7 NAD_binding_8 K_oxygenase Glutaredoxin 3HCDH_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AIF98763
UniProt: A0A075NYY5
LinkDB All DBs
Position
1930387..1931976
Genome map
AA seq 529 aa AA seqDB search
MLTKEILQALKGYTESMQKNVTFVVQTGEHSKRAELVSFLSDIAGVSDKLNVEERDTQGQ
LRSAISFLLEADGQDTGIRFSGIPGGHEFNSLILAILHASGTELKVDDSVKSIVKAVKDE
LNFEVFISLSCHNCPEVVQALNQFALLNDNITSEMIDGGLYQNLISERDIQGVPSVYLNG
ELFANGKVDAASLIDKLIERDPSLKEANTGVQLPLQDVTVIGGGPAGVASAIYSARKGLK
VTVVAESFGGQVKDTMGIENLISVPKTTGPELVGNLMEHVNDYDITLKEHVRVENIEKGN
VKTITLSSGEQIRTRSLVVATGARWRELGVPGERENVGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPTLKADQVLIDQAEKRDNITIIKNAATRQILAEN
GKVNAIEYQDRSTNEVHTLDLAGVFVQIGLVPNSQFMKDVVEMTPYGEIVVDTKCQTSEA
GIFAAGDVTTVPYKQIVISMGEGAKASLAAFEYLLSHEVIESEDESAAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactaaagaaattttgcaagcattgaaaggctacaccgagtcaatgcaaaaaaac
gtaacctttgtcgtacagactggtgaacacagcaagcgtgctgagcttgtgtcgtttctg
tccgacattgcaggtgtaagcgataaattaaatgttgaagaacgtgatacgcaaggtcaa
ttgcgtagcgcaatcagtttcctacttgaagccgatggccaagatacggggattcgcttc
tcaggcattccaggcgggcatgagttcaactcactgatccttgctattcttcacgcctca
ggaactgaactgaaagtagacgacagcgttaaatctatagttaaagctgtaaaagacgaa
cttaactttgaagtgttcatcagccttagctgtcacaactgcccagaagttgtgcaggcg
cttaatcaattcgcgctattgaacgacaatattacgtctgaaatgattgacggtggatta
tatcaaaacctgatcagtgagcgagacattcaaggcgttccaagcgtttacctaaacggc
gagttatttgccaacggtaaagttgacgcagcctcacttatcgacaagcttattgagcgc
gatccgtcgttaaaagaagcgaatacaggcgtacaattaccacttcaagatgtcaccgta
attggtggtggtcctgcaggcgtagcgtctgctatatacagtgctcgtaaaggcctgaaa
gttaccgtcgtggctgaaagctttggtggccaagtaaaagatactatgggtattgagaat
cttatctctgtaccaaaaaccacaggcccagagcttgttggtaatttgatggaacacgtt
aacgattacgacattacgcttaaagagcatgtgcgtgttgagaatatcgaaaaaggtaat
gtgaagaccatcacactgtcttcgggtgaacaaattcgtacccgttcactggtggttgcc
actggtgctcgctggagagagttgggcgtgcccggtgagagagagaatgttggtaatggt
gttgcgtattgtccgcactgtgatggtccattctttaaaggtaaagatgtggctgttatt
ggcggcggtaactcaggtattgaagctgcactagatttggcaggcattgtaaaatcggta
accgtatttgaatttatgcctacgcttaaggccgatcaggtactgattgaccaagctgaa
aagcgtgacaatattacgattattaagaatgccgctacccgtcagattttggctgaaaac
ggtaaagtcaatgccattgaatatcaagatagaagtactaatgaagtgcatactcttgac
ttagcaggtgtattcgtccaaatcgggttggttcctaatagccaattcatgaaagatgtg
gtggaaatgacaccgtatggcgagattgttgtagatactaagtgtcaaacttctgaagca
ggcatttttgctgcgggtgacgtgacaactgtaccctacaagcaaatcgttatttcaatg
ggcgagggcgcaaaagcttctcttgcagcatttgaatacttactcagtcacgaagttatt
gagtctgaagacgaaagtgctgctgcataa

DBGET integrated database retrieval system