KEGG   Alteromonas australica H 17: EP13_14445Help
Entry
EP13_14445        CDS       T03220                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aal  Alteromonas australica H 17
Pathway
aal00473  D-Alanine metabolism
aal00550  Peptidoglycan biosynthesis
aal01100  Metabolic pathways
aal01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:aal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EP13_14445
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EP13_14445
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EP13_14445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aal01011]
    EP13_14445
Enzymes [BR:aal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EP13_14445
Peptidoglycan biosynthesis and degradation proteins [BR:aal01011]
 Precursor biosynthesis
  Amino acid ligase
   EP13_14445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp GARS_A ATPgrasp_ST ATP-grasp_3 ATPgrasp_Ter ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AIF99784
UniProt: A0A075NYS8
LinkDB All DBs
Position
complement(3208080..3209036)
Genome map
AA seq 318 aa AA seqDB search
MAADVFGKVAVMFGGDSAEREVSLSSGTAVLNALLRQGVNAVAFDPAAQPLTDLLTQQID
RVLIMLHGRGGEDGSMQGALQLLNVPYTGSRVLGSALAMDKIHTKQVWQSLGLPTAKYEI
ADKRHFEAGSCGAIMDKLGNEVMVKPAREGSSIGMARVTSAKQLDIAIQNAFKYDNQVLL
EEYIDGPEFTVSVIQGQALPSIRMSTPHTFYDYAAKYQDDTTEYFCPSGLSQDQEAQLAE
LATRAFDGISGSGWGRIDVMQDSQGQFYLLEANTVPGMTEKSLVPKAAKVAGLTFDELVM
AILATSMEDEQVTVMAGA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atcgctgctgatgtatttggcaaagttgccgtcatgtttggaggcgactcagcagagcgt
gaagtgtcgctaagttcgggtaccgctgtgctaaatgccttgttgcgccaaggtgtaaac
gcggtggccttcgaccccgccgcccaaccattgacagatttactcacccaacaaatagac
cgcgtactcattatgctgcacggtcgggggggagaagatggctctatgcagggggcatta
caactgctaaatgtgccctataccggcagccgtgtattaggctcagcactggcgatggat
aaaatccatactaagcaagtttggcaaagcttggggctgcccaccgcaaaatatgaaatt
gctgataaaaggcactttgaagctggatcatgcggcgctataatggataaattggggaat
gaagtcatggtaaaaccggccagagaagggtcgagtattggcatggcaagagtgacaagc
gctaaacaactcgatattgcgattcagaacgcattcaaatatgacaatcaggttctgtta
gaggaatacattgacggcccagagtttactgtttctgtgatacaggggcaggcgttgccg
tctattcgcatgtccacccctcatacgttttacgattacgctgcgaaataccaggatgac
acaacggaatatttctgtccaagtggtttatcgcaagatcaagaagcccagttagccgaa
ttagctacccgtgcatttgacggaatttcaggttcgggctgggggcgtatcgatgtcatg
caagacagccaagggcagttttacttgcttgaagcgaacacggtacccggcatgacagaa
aaaagtttggttcccaaagccgcgaaagtggcgggattaacgtttgatgagctggttatg
gcgattttagcaaccagcatggaagatgaacaagtaactgtcatggcaggagcataa

DBGET integrated database retrieval system