KEGG   Aedes albopictus (Asian tiger mosquito): 109399760
Entry
109399760         CDS       T06060                                 

Definition
(RefSeq) cell death protein hid
  KO
K20016  cell death protein hid
Organism
aalb  Aedes albopictus (Asian tiger mosquito)
Pathway
aalb04013  MAPK signaling pathway - fly
aalb04214  Apoptosis - fly
aalb04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:aalb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    109399760
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    109399760
   04215 Apoptosis - multiple species
    109399760
SSDB
Other DBs
NCBI-GeneID: 109399760
NCBI-ProteinID: XP_029727133
LinkDB
Position
Unknown
AA seq 412 aa
MAIPFLQPEEDESARHHGANGPNTASAHAGVGAGAGSSGTGSASASGSGAVVVGGAGSSG
GAVMLAGATGPMPVPNSPAAPIISSGTSTAVQTPLIGPMNSDQLVQLFYEALYRYSRGDT
PSTPISQSPQSSSCSPFTTGYYNSGGGGSAGYANATTTGQVFFPQTPNGVFRPGGGGGGI
GSYGATTGVFFGQPPTPSPSGSSSHSQHSANSPDTAACSSAPPIIHQFPSSYQLPSTSNA
STATNWTHVSSGDGDDSSESDSSQPSSASDGDSITAPIAGCSPHCLGLLGPPHHHLHQLL
DAAAAAGSGSSTGVSSSFNNGSSSSSSSNSAGGSSAMVPMSGCIPPHLDYMAGREQLQEF
AGKIPQRKKKSSSSKSSSKSKKSKFLEQTLVWPTLAVTATLIALGCGLLAAR
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggcaattccattcttgcaaccggaagaggacgaaagcgcccggcaccacggtgctaat
gggcccaacacagcaagtgcccatgccggtgttggagctggtgctggaagtagcggcacc
ggtagtgctagtgcaagtggtagtggtgccgttgttgttggtggagccggtagtagcgga
ggcgccgtaatgttggctggtgctaccgggcccatgccagttccaaactcgccggctgcc
cccatcatcagcagtgggacatcgaccgcagtgcagacgcccctcatcgggccgatgaac
agcgatcagttggtgcagcttttctacgaggcgctctatcgttattcgagaggagatacc
ccttcgacgccgatctcgcagtcaccgcaaagttcgtcctgcagtccattcaccaccggg
tattacaacagcggaggtggaggaagtgcaggatatgccaacgccaccaccactggccag
gtgttcttcccacaaacccccaacggagtgtttcgtccgggtggtggtggtggcggcatc
ggaagctacggtgctactacaggagtgttcttcggacagccaccaacgccaagccccagt
ggaagcagtagccacagccaacacagtgccaacagtccggatacggcggcctgctcatcg
gcaccaccgattattcaccagttcccatcaagctaccaactgcccagcacctctaacgcc
agcaccgcaaccaactggacccacgtttccagtggagatggagatgattccagcgaatcg
gactcgtctcagccatcatcagcttcggatggggacagtataaccgctcccattgccgga
tgcagcccgcactgtctaggactgctggggccgccacatcaccatctgcatcaactcctc
gatgctgctgctgctgctggaagtggtagcagcaccggcgtcagtagcagtttcaacaat
ggcagtagcagcagcagcagtagcaacagcgccggtggtagtagcgctatggtaccgatg
agtgggtgcattccaccgcatttggactatatggctgggcgcgaacagctgcaggagttt
gccggcaagatccctcagcgcaagaagaaatcatcgtcgtccaaatcttcgagcaagtcc
aagaaatctaagtttctggagcaaaccctcgtctggccaacgctagccgtgaccgccacg
ctgatcgcccttgggtgtggcctactagctgccaggtga

DBGET integrated database retrieval system