KEGG   Aedes albopictus (Asian tiger mosquito): 109401930
Entry
109401930         CDS       T06060                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member wengen
  KO
K16679  wengen
Organism
aalb  Aedes albopictus (Asian tiger mosquito)
Pathway
aalb04013  MAPK signaling pathway - fly
aalb04214  Apoptosis - fly
aalb04215  Apoptosis - multiple species
aalb04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:aalb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    109401930
   04391 Hippo signaling pathway - fly
    109401930
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    109401930
   04215 Apoptosis - multiple species
    109401930
SSDB
Motif
Pfam: TNFR_c6 CENP-Q Trp_oprn_chp
Other DBs
NCBI-GeneID: 109401930
NCBI-ProteinID: XP_029710551
LinkDB
Position
Unknown
AA seq 385 aa
MPPWIESMEQQRRRSTRHPTGISSNNSWSVRSVMYSSGSSDSVRISHGDSSLSSVAVSAT
TTTPGSFHHRLRWVLGLVTLLAVLSGTEAVCDPDRWWNLEREECDPCTVCGEQQLVLRPC
QEYMDTVCGTIGDLDMDLAQLARTEARHEQRHWKEERRKDGSDGHQHRPLHGQHHGPANG
QHPGHAGSARKHENTEEILWDWQAASLLLAIIGCLMFFFAAAIIALNQTRQWKRIEKHFD
ADMEALSAQLMNHLSSMQQLENGSIFLDDVLGGGGVGGGGGGDHPRRFLRGERSVDSTSS
TSALLGGHHHHHHHHPIEVRCVYLDELLDGKNCIQSQGPGNLYIEETNNTNTTTNVDRGP
TSTPAACHLPSTNCGSSPLNRVRLY
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgccaccttggatcgagtccatggagcagcagcgcagaagatccacgcgacacccgacc
gggatcagcagcaacaatagctggtccgtccgatcagtcatgtacagtagtggtagcagc
gatagtgttagaatcagccatggtgatagttccttaagttcagtagcagtaagtgcgacg
acgacgacaccggggtcgttccatcataggttaagatgggtgctggggttggtgaccctg
ttggcagtattatccgggacagaagcggtgtgtgatccggatcggtggtggaatctggaa
cgggaagagtgcgatccgtgtacggtttgtggtgagcagcagctggtcctgcggccctgt
caggagtacatggacacggtttgcgggacgatcggtgatctggatatggatctggcgcag
ttggcgcggaccgaggcgcgccacgagcagcgccactggaaggaggaacgtcggaaagat
ggctccgacgggcaccagcatcggccgctgcacggtcagcatcatggcccggccaacggc
caacacccgggccacgcgggctcggcccgaaagcacgagaacaccgaggaaatcctgtgg
gattggcaagcggcctcgctgctcctggccatcatcgggtgtttgatgttcttcttcgcg
gcggccatcattgcgctcaaccagacgcgccagtggaaacggatcgagaagcacttcgat
gcagatatggaggccctctcggcgcagctgatgaaccatctgtccagcatgcagcagctc
gagaacggatcgatcttcctggacgacgtgcttggcggaggcggcgtcggtggcggcggt
ggcggagatcatccgcggcggttcctccgaggggaacgaagcgtagacagcacgagcagt
accagcgccctgctcggaggccaccaccaccatcatcatcaccacccgatcgaggtgcgc
tgtgtctacttggatgagttgctagacggcaaaaattgcatccaaagtcaaggtccgggc
aatttgtacattgaagagacaaacaacaccaatactaccaccaatgtggaccgtggacca
acgtcaacaccagcagcgtgtcatcttccttccacaaactgtggctcttccccgttgaat
cgagttcgattgtattga

DBGET integrated database retrieval system