KEGG   Aedes albopictus (Asian tiger mosquito): 109408756Help
Entry
109408756         CDS       T06060                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHR1-like isoform X1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
aalb  Aedes albopictus (Asian tiger mosquito)
Pathway
aalb00310  Lysine degradation
aalb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aalb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109408756
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aalb03036]
    109408756
Enzymes [BR:aalb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     109408756
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     109408756
Chromosome and associated proteins [BR:aalb03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109408756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND DUF3232
Motif
Other DBs
NCBI-GeneID: 109408756
NCBI-ProteinID: XP_029723921
LinkDB All DBs
Position
Unknown
AA seq 411 aa AA seqDB search
MKIESGERVIPEVLKKGMNLESNLSIPCLAKGVGTGEFPHYGRGMKAEQDFKVGDVILRE
GPAMVNVDTRRKFQACHHCASDNVYSLIPCPHCVFVIYCNEECLTNGWKECHRFECGIKD
RLNMVPHGIFIPGLTWLFYGLTQFNDSLDDMMNYCKENDRNGNDPLSLEYTNPLDIFKLF
HTAKVKPLSPQVHTYNRFILAILYDIYLEHPLVGSLFVGENQRNFLLQAMDDYMTMATRM
SIGVRHEYKTELYSIASLCNHSCNPNAHALYSSGQIKIVVVSPIQKGEQICISYGYVKDE
VSDARFFAQMGVFDFTCICQVCAPNSSQEKLSKNRRQPHHSFHSDLRVLNKIIENENSIA
SDRINALQQFIQRYAEGHPPGEYAKLLRKYRTILQKLFEDEVLGELIRKLN
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgaatccggagaaagagtgatcccggaagtgctgaagaaggggatgaatttg
gaatctaatctctccattccttgtttagcgaagggcgtcggaacaggcgaattcccacat
tacggacgaggcatgaaggccgaacaggacttcaaagttggagatgtcattcttcgagaa
ggaccagcaatggtaaacgttgatacgagacgtaaatttcaagcttgccatcattgtgca
tcggacaatgtctactcattgattccatgtccgcactgcgtatttgtgatttactgcaac
gaagaatgcttgacgaacggttggaaggaatgccatcgtttcgagtgcggcataaaagat
agactgaatatggttcctcatggtattttcattcctggattgacatggctcttctatggg
cttacacagttcaacgacagcttggacgatatgatgaactactgcaaagaaaatgaccgc
aatggaaatgatcctctcagtttggaatacactaatccgttggacattttcaaactgttt
cataccgcaaaggttaagccactcagccctcaagtgcacacttacaaccgtttcattttg
gcgatcctttatgacatctacctcgaacatccattggtaggttcgttattcgtcggtgaa
aatcagcgaaattttctgttgcaagccatggacgactacatgactatggcgaccagaatg
agtattggcgtaagacacgaatataaaaccgaactatactcgattgcatcactctgcaac
cattcttgcaatcccaacgcacacgcactgtacagttctggacagatcaaaatcgttgtg
gtaagcccaatccaaaagggtgagcaaatctgcatctcgtacggttacgtaaaggacgaa
gtctccgacgctcgattttttgcgcaaatgggggtgtttgatttcacttgcatttgccaa
gtatgcgctccaaactcaagtcaagagaagctgagcaagaacagacgccaaccgcaccat
tcatttcacagcgatttgcgcgtgttgaataaaataattgagaacgaaaatagcattgca
tcggataggattaacgctctgcagcaattcattcaacggtatgccgagggtcatcctccg
ggtgagtacgcaaagctgcttcggaagtaccgaacaatattgcagaaattgtttgaagat
gaggttttgggggagttgatcagaaagttgaactaa

DBGET integrated database retrieval system